DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpina1a

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001239498.1 Gene:Serpina1a / 20700 MGIID:891971 Length:436 Species:Mus musculus


Alignment Length:385 Identity:81/385 - (21%)
Similarity:143/385 - (37%) Gaps:66/385 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEYKPKTQKIFAMS 90
            ||..:|:..:..||.||...|.::...:.:|.:.|...||.:.:.:..|..||            
Mouse    78 LYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSE------------ 130

  Fly    91 VKKAPVAKSLTRFYVRQN-----MKMSTEYRVFMRHTEGRARNIAFAREQLDEVNTFYSHEM--- 147
               |.:.||........|     :::||...:|:.:      ::....:.|:|....|..|:   
Mouse   131 ---ADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNN------DLKLVEKFLEEAKNHYQAEVFSV 186

  Fly   148 ----GEQIGQVVKESWWKPNSQG---------------LLVNAIFFNLSWERTFNPEATYPREFR 193
                .|:..:|:.: :.:..:||               .|.|.|.|...|::.|:||.|...||.
Mouse   187 NFAESEEAKKVIND-FVEKGTQGKIAEAVKKLDQDTVFALANYILFKGKWKKPFDPENTEEAEFH 250

  Fly   194 VNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGL-----AALQMKL 253
            |:.:.:|.:|||.............|.:..:|:.:: |:...:.:.||  ||.     ..|..:|
Mouse   251 VDESTTVKVPMMTLSGMLHVHHCSTLSSWVLLMDYA-GNATAVFLLPD--DGKMQHLEQTLSKEL 312

  Fly   254 QAMNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDG 318
            .:..:|:..|.|..    :..|:..|..:..|......:||..||......|.:...|...::..
Mouse   313 ISKFLLNRRRRLAQ----IHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQ 373

  Fly   319 VIHVVTFEFQEQGIGTPSTDVGNGSLTHTFNGVKYFLATHPFAFYIID--NTSIYFAGHV 376
            .:|.......|.|....:..|.. .:..:...:..|  .|||.|.|.:  ..|..|.|.|
Mouse   374 AVHKAVLTIDETGTEAAAVTVLQ-MVPMSMPPILRF--DHPFLFIIFEEHTQSPIFLGKV 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 80/383 (21%)
Serpina1aNP_001239498.1 SERPIN 76..433 CDD:214513 81/385 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.