DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpinf1

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_035470.3 Gene:Serpinf1 / 20317 MGIID:108080 Length:417 Species:Mus musculus


Alignment Length:382 Identity:82/382 - (21%)
Similarity:163/382 - (42%) Gaps:43/382 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QLPDELYAAIVNSFS------------NRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHY-- 71
            ::|....||.|::|.            ..|::.|...:.:::..:.:|.|......|.:|::|  
Mouse    47 KVPVNKLAAAVSNFGYDLYRLRSSASPTGNVLLSPLSVATALSALSLGAEHRTESVIHRALYYDL 111

  Fly    72 ---RGTHLSEYKPKTQKIFAMSVKKAPVAKSLTRFYVRQNMKMSTEYRVFMRHTEGRARNIAFA- 132
               ...| |.||    ::.|.........||.:|....:.:::.:.:...:..:.|....|... 
Mouse   112 ITNPDIH-STYK----ELLASVTAPEKNLKSASRIVFERKLRVKSSFVAPLEKSYGTRPRILTGN 171

  Fly   133 -REQLDEVNTFYSHEMGEQIGQVVKESWWKPNSQG-LLVNAIFFNLSWERTFNPEATYPREFRVN 195
             |..|.|:|.:...:|..:|.:..:|   .|::.. ||:...:|...|...|:...|..::|.::
Mouse   172 PRVDLQEINNWVQAQMKGKIARSTRE---MPSALSILLLGVAYFKGQWVTKFDSRKTTLQDFHLD 233

  Fly   196 ATKSVMIPMMHEDSK--FAFGILGNLKATAVLVPFSHGDLRMLLIKP-DQPDGLAALQMKLQAMN 257
            ..::|.:||| .|.|  ..:|:..:|......:|.: |.:.::...| .....|..::..|.:..
Mouse   234 EDRTVRVPMM-SDPKAILRYGLDSDLNCKIAQLPLT-GSMSIIFFLPLTVTQNLTMIEESLTSEF 296

  Fly   258 ILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHV 322
            |..:.|.|..:...:.:||.|:..:.||:.:.:.|.::.:|: |..||.:..:..  ::..|.|.
Mouse   297 IHDIDRELKTIQAVLTVPKLKLSFEGELTKSLQDMKLQSLFE-SPDFSKITGKPV--KLTQVEHR 358

  Fly   323 VTFEFQEQGIG-TPSTDVGNGSLTHTFNGVKYFLATHPFAFYI--IDNTSIYFAGHV 376
            ..||:.|:|.| :||..:....||...:   |.| ..||.|.:  .|..::.|.|.:
Mouse   359 AAFEWNEEGAGSSPSPGLQPVRLTFPLD---YHL-NQPFLFVLRDTDTGALLFIGRI 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 81/376 (22%)
Serpinf1NP_035470.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..41
PEDF 39..414 CDD:239007 82/382 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.