DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpinb3a

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_033152.3 Gene:Serpinb3a / 20248 MGIID:3573933 Length:387 Species:Mus musculus


Alignment Length:393 Identity:91/393 - (23%)
Similarity:176/393 - (44%) Gaps:41/393 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AQKNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEYK 80
            |:..::...|||..:..  |:.||.:|...:.:::..:.:|.:.:..:||.|.:.:     :|..
Mouse     5 AEATTKFTLELYRQLRE--SDNNIFYSPISMMTALAMLQLGAKGNTEKQIEKVLQF-----NETT 62

  Fly    81 PKTQKIFAMSVKKAPVAKSLTRFYVRQNMKMSTEYRVFMRHTEGRARNIAFAREQLDEVNTFY-- 143
            .||.:..|....:..|.:...:...:.| |.:..|.:...::...|:...|.:..|:::..:|  
Mouse    63 KKTTEKSAHCHDEENVHEQFQKLMTQLN-KSNDAYDLKAANSIYGAKGFPFVQTFLEDIKEYYQA 126

  Fly   144 -------SHEMGEQIGQVVKESWWKPNSQG-----------------LLVNAIFFNLSWERTFNP 184
                   .|...|...::  .||.:..:.|                 :||||::|...|...|:.
Mouse   127 NVESLDFEHAAEESEKKI--NSWVESQTNGKIKDLFPNGSLNRSTIMVLVNAVYFKGQWNHKFDE 189

  Fly   185 EATYPREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAAL 249
            :.|...:|.:|...|..:.||.::.:|.|..|.:::|..|.:|:...:|.|:::.|.:.:||..|
Mouse   190 KHTTEEKFWLNKNTSKPVQMMKQNIEFNFMFLEDVQAKIVEIPYKGKELSMIVLLPVEINGLKQL 254

  Fly   250 QMKLQAMNIL--SVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNT 312
            :.:|.|..:|  :.|.|:.|.::::.:|:||:....:|....|.||:.|.|.|.|:..:.:....
Mouse   255 EEQLTADKLLEWTRAENMHMTELYLSLPRFKVDEKYDLPIPLEHMGMVDAFDPQKADFSGMSSTQ 319

  Fly   313 NFRIDGVIHVVTFEFQEQGIGTPSTDVGNGSLTHTFNGVKYFLATHPFAFYII--DNTSIYFAGH 375
            ...:..|:|....|..|:|....:......||| :....:.|...|||.|:||  ...||.|.|.
Mouse   320 GLVVSKVLHKSFVEVNEEGTEAAAATGVEVSLT-SAQIAEDFCCDHPFLFFIIHRKTNSILFFGR 383

  Fly   376 VTS 378
            ::|
Mouse   384 ISS 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 89/380 (23%)
Serpinb3aNP_033152.3 SERPIN 5..387 CDD:294093 91/393 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.