DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpina12

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_620180.2 Gene:Serpina12 / 191570 RGDID:708485 Length:414 Species:Rattus norvegicus


Alignment Length:403 Identity:85/403 - (21%)
Similarity:159/403 - (39%) Gaps:67/403 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ISRYRAQK--------NSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIR- 66
            :..:|.:|        |.:...:|...:.::....||..|...|.::...:.:|.:....|:|| 
  Rat    36 VQEWRGKKDARELTRHNMEFGFKLLQRLASNSRQGNIFLSPLSISTAFSMLSLGAQNSTLEEIRE 100

  Fly    67 ----KAMHYRGTHLSEYKPKTQKIFAMSVKKAPVAKSLTRFYVRQNMKMSTEYRVFM-RHTEGRA 126
                |.|..|..|:.         |...::|      |.|  ..|::|||....:|| :....:.
  Rat   101 GFNFKEMSDRDMHMG---------FHYLLQK------LNR--ETQDVKMSIGNALFMDQRLRPQQ 148

  Fly   127 RNIAFAREQLD----------------EVNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFN 175
            |.:..|:...|                .:|.:.|.:...:|..:||..  .|.:..||.|.|:|.
  Rat   149 RFLKLAKNLYDADMILTNFQDLENTQKNINKYISRKTHNRIENMVKNI--DPGTVMLLTNYIYFQ 211

  Fly   176 LSWERTFNPEATYPREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKP 240
            ..|:..|:|:.|...:|.:...|:|.:|||.:...:.......|..|.:.:|:.. ::....:.|
  Rat   212 GRWQYEFDPKQTKEEDFFIEEGKTVKVPMMFQRGMYDMAYDSQLSCTILEMPYRR-NITATFVLP 275

  Fly   241 DQPDGLAALQMKLQAMNILSVARNL---TMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSK 302
            |. ..|..|:..||| :|.:..::|   .::||:|  |:..|.:...:.....::||..||:...
  Rat   276 DS-GKLRLLEQGLQA-DIFAKWKSLLSKRVVDVWV--PRLHISATYNMKKVLSRLGISKIFEEHG 336

  Fly   303 SFSTLLHRNTNFRIDGVIHVVTFEFQEQGIGTPSTD--VGNGSLTHTFNGVKYFLATHPFAFYII 365
            .. |.:..:.:.::...:|.......|:|     |:  .|:|:.|......:......||...|.
  Rat   337 DL-TRISSHRSLKVGEAVHKAELRMNEKG-----TEGAAGSGAQTLPMETPRRMKLNAPFLMMIY 395

  Fly   366 DN--TSIYFAGHV 376
            :|  .|:.|...:
  Rat   396 ENLMPSMIFLARI 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 82/379 (22%)
Serpina12NP_620180.2 alpha-1-antitrypsin_like 51..408 CDD:239011 83/386 (22%)
Reactive center loop. /evidence=ECO:0000250|UniProtKB:Q8IW75 364..382 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.