DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpina10

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_598301.2 Gene:Serpina10 / 171154 RGDID:621220 Length:436 Species:Rattus norvegicus


Alignment Length:423 Identity:96/423 - (22%)
Similarity:168/423 - (39%) Gaps:103/423 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SRYRAQKNSQLPDELYA---AIVNSFSNR---NIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMH 70
            :.|..:.:.||.:|..:   :::...|.|   |::||...:..:|:.:.:|.:.:...|:...::
  Rat    57 NEYWLRASQQLSNETSSFGFSLLRKISMRHDGNVIFSPFGLSVAMVNLMLGAKGETKVQVENGLN 121

  Fly    71 YRGTHLSEYKP---------------------KTQKIFA-----MSVKKAPVAKSLTRF---YVR 106
            .:.  ||:..|                     .||..||     ..:||.....|...|   ||.
  Rat   122 LQA--LSQAGPLILPALFKRVKETFSSNKKLGLTQGSFAFIHKDFEIKKTYFNLSTMYFDTEYVP 184

  Fly   107 QNMKMSTEYRVFMRH-----TEGRARNIAFAREQLDEVNTFYSHEMGEQIGQVVKESWWKPNSQG 166
            .|.:.|::.|..|.|     |||:...:      .||:|                     |.::.
  Rat   185 TNFRNSSQARGLMNHYINKETEGKIPKL------FDEIN---------------------PETKL 222

  Fly   167 LLVNAIFFNLSWERTFNPEATYPREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHG 231
            :||:.|.|...|...|:|..|....|.::..|:|.:|||:.:..||.......:...:.:|: .|
  Rat   223 ILVDYILFKGKWLTPFDPIFTEADTFHLDKYKAVKVPMMYREGNFASTFDKKFRCHILKLPY-QG 286

  Fly   232 DLRMLLIKPDQP-DGLA--------ALQMKLQAMNILSVARNLTMMDVFVGIPKFKIHSDLELSP 287
            :..||::..::. |.||        .::|.||.|       ....|:||  .||||::...|:..
  Rat   287 NATMLVVLMEKSGDHLALEDYLTTDLVEMWLQDM-------KTRKMEVF--FPKFKLNQRYEMHE 342

  Fly   288 AFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFEFQEQGIGTPSTDVGNGSLTHTFNGVK 352
            ..:::||:.||..|...|.|.....|.::..|:.....|..|:|     |:|.:|:::..   ..
  Rat   343 LLKQVGIRRIFSTSADLSELSAVARNLQVSKVVQQSVLEVDERG-----TEVVSGTVSEI---TA 399

  Fly   353 YFL-----ATHPFAFYIIDNTS--IYFAGHVTS 378
            |.:     ...||.|.|.:..|  :.|.|.|.:
  Rat   400 YCMPPVIKVDRPFHFIIYEEMSQMLLFLGRVVN 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 92/406 (23%)
Serpina10NP_598301.2 SERPIN 66..430 CDD:294093 94/410 (23%)
Heparin-binding. /evidence=ECO:0000250 128..145 1/16 (6%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.