DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and SERPINA12

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001291390.1 Gene:SERPINA12 / 145264 HGNCID:18359 Length:414 Species:Homo sapiens


Alignment Length:388 Identity:80/388 - (20%)
Similarity:153/388 - (39%) Gaps:51/388 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AQKNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYR-------- 72
            |::|..|..:|...:......|||..|...|.::...:.:|.::...::|::..::|        
Human    49 ARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLH 113

  Fly    73 -GTH--LSEYKPKTQKIFAMSVKKAPVAKSLTRFYVRQNMKMSTEYRVFMRHTEG---------R 125
             |.|  :.|...|||.:      |..:..:|   ::.|.::   ..|.|:...:.         .
Human   114 EGFHYIIHELTQKTQDL------KLSIGNTL---FIDQRLQ---PQRKFLEDAKNFYSAETILTN 166

  Fly   126 ARNIAFAREQLDEVNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEATYPR 190
            .:|:..|::|   :|.|.|.:...:|..:::..  .|.:..||.|.|||...|:..|:|..|...
Human   167 FQNLEMAQKQ---INDFISQKTHGKINNLIENI--DPGTVMLLANYIFFRARWKHEFDPNVTKEE 226

  Fly   191 EFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQMKLQA 255
            :|.:....||.:|||.....:..|....|..|.:.:|:.. ::..:.|.||: ..|..|:..||.
Human   227 DFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQK-NITAIFILPDE-GKLKHLEKGLQV 289

  Fly   256 MNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLL-HRNTNFRIDGV 319
            .........|:...|.|.:|:..:....:|......:|:..||:.....:.:. ||  :.::...
Human   290 DTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHR--SLKVGEA 352

  Fly   320 IHVVTFEFQEQGIGTPSTD--VGNGSLTHTFNGVKYFLATHPFAFYIIDN--TSIYFAGHVTS 378
            :|....:..|:|     |:  .|.|:.|.............|:...|...  .|:.|.|.:.:
Human   353 VHKAELKMDERG-----TEGAAGTGAQTLPMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVN 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 77/375 (21%)
SERPINA12NP_001291390.1 serpinA12_vaspin 40..411 CDD:381026 80/388 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.