DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpinh1

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001104513.1 Gene:Serpinh1 / 12406 MGIID:88283 Length:417 Species:Mus musculus


Alignment Length:376 Identity:78/376 - (20%)
Similarity:151/376 - (40%) Gaps:28/376 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AQKNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEYK 80
            |::::.|...||.|:....:..||:.|..::.||:..:.:|.:...:.|.:..       ||..|
Mouse    43 AERSTGLAFSLYQAMAKDQAVENILLSPLVVASSLGLVSLGGKATTASQAKAV-------LSAEK 100

  Fly    81 PKTQKI----------FAMSVKKAPVAKSLTRFYVRQNMKMSTEY-RVFMRHTEGRARNIAF--A 132
            .:.:::          .:.|..:....|..:|.|...::..:.:: |...:|.......|.|  .
Mouse   101 LRDEEVHTGLGELLRSLSNSTARNVTWKLGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFRDK 165

  Fly   133 REQLDEVNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEATYPREFRVNAT 197
            |..|..:|.:.|.....::.:|.|:.  :.....|||||:||...|:..|:.:....|.|.|..:
Mouse   166 RSALQSINEWASQTTDGKLPEVTKDV--ERTDGALLVNAMFFKPHWDEKFHHKMVDNRGFMVTRS 228

  Fly   198 KSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQMKLQAMNILSVA 262
            .:|.:.|||....:.:......|...|.:|.:|....::::.|...:.|..|:..|....:.:..
Mouse   229 YTVGVTMMHRTGLYNYYDDEKEKLQMVEMPLAHKLSSLIILMPHHVEPLERLEKLLTKEQLKAWM 293

  Fly   263 RNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFEF 327
            ..:....|.:.:||..:....:|......:|:.:....:|:..:.:....:..:..|.|...||:
Mouse   294 GKMQKKAVAISLPKGVVEVTHDLQKHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFEW 358

  Fly   328 QEQGIGTPSTDVGNGSLTHTFNGVKYFLATHPFAFYIIDNT--SIYFAGHV 376
            ..:|........|...|    ...|.|.|.|||.|.:.||.  |:.|.|.:
Mouse   359 DTEGNPFDQDIYGREEL----RSPKLFYADHPFIFLVRDNQSGSLLFIGRL 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 76/365 (21%)
Serpinh1NP_001104513.1 serpinH1_CBP1 35..416 CDD:381003 78/376 (21%)
Prevents secretion from ER. /evidence=ECO:0000305 414..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.