DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpina6

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_031644.1 Gene:Serpina6 / 12401 MGIID:88278 Length:397 Species:Mus musculus


Alignment Length:393 Identity:85/393 - (21%)
Similarity:148/393 - (37%) Gaps:88/393 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AQKNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEYK 80
            |..|......||..:|...|::|.:.|...|  ||....:.:....|.|..:.:.:..:.:||.:
Mouse    35 APTNVDFAFNLYKRLVALNSDKNTLISPVSI--SMALAMLSLSTRGSTQYLENLGFNMSKMSEAE 97

  Fly    81 PKTQKIFAMS-VKKAPVAKSLTR---FYVRQNMKMSTEYRVFMRHTEGRARNIAFAREQLDEVNT 141
            ......:..| ::::.....:..   .::.||:|:...:....:|                    
Mouse    98 IHQGFQYLNSLLQQSDTGLEMNMGNVMFLLQNLKLKDSFLADTKH-------------------- 142

  Fly   142 FYSHE-----------MGEQIGQVVKESWWKPNSQG---------------LLVNAIFFNLSWER 180
            :|..|           .||||...||.     .:||               :|:|.||....|:.
Mouse   143 YYESEALTIPSKDWTKAGEQINNHVKN-----KTQGKIEHVVSDLDSSATLILINYIFLKGIWKL 202

  Fly   181 TFNPEATYPREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAV---LVPFSH-GDLRMLLIKPD 241
            .|:||.|...:|.||.|.:|.:|||.:....::     .:.:|:   :|..:: |:....:|.||
Mouse   203 PFSPENTREEDFYVNETSTVKVPMMVQSGNISY-----FRDSAIPCQMVQMNYVGNGTTFIILPD 262

  Fly   242 Q---PDGLAALQM-KLQAMNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSK 302
            |   ...:|||.. .:.....|.:.|.:.:.     ||||.:....:|......:||||:|....
Mouse   263 QGQMDTVVAALNRDTIDRWGKLMIPRQMNLY-----IPKFSMSDTYDLQDVLADVGIKDLFTNQS 322

  Fly   303 SFSTLLHRNTNFRIDGVIHVVTFEFQEQGIGTPSTDVGNGSLTH----TFNGVKYFLATHPFAFY 363
            .|:... ::|...:. |:|....:..|..:...:|   ||...|    :|. :||   ..||.|.
Mouse   323 DFADTT-KDTPLTLT-VLHKAMLQLDEGNVLPAAT---NGPPVHLPSESFT-LKY---NRPFIFL 378

  Fly   364 IID 366
            ..|
Mouse   379 AFD 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 83/384 (22%)
Serpina6NP_031644.1 SERPIN 43..396 CDD:214513 83/385 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.