DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpinc1

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_543120.1 Gene:Serpinc1 / 11905 MGIID:88095 Length:465 Species:Mus musculus


Alignment Length:419 Identity:92/419 - (21%)
Similarity:158/419 - (37%) Gaps:98/419 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AQKNSQLPDELYAAIVNSFS-NRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEY 79
            ::.||:.....|..:.:|.: |.||..|...|.::.....:|...|..:|:              
Mouse    85 SKANSRFATNFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLKQL-------------- 135

  Fly    80 KPKTQKIFAMSVKKAPVAKSLTRFYVRQNMKMSTEYRVFMRHTEGRARNIAFAREQLDEVNTFYS 144
                .::|.........:..:..|:.:.|.::   ||...:.::..:.|..|..:.|    ||  
Mouse   136 ----MEVFKFDTISEKTSDQIHFFFAKLNCRL---YRKANKSSDLVSANRLFGDKSL----TF-- 187

  Fly   145 HEMGEQIGQVV----------KE----------SWWKPNSQG-----------------LLVNAI 172
            :|..:.:.:||          ||          :|....::|                 :|||.|
Mouse   188 NESYQDVSEVVYGAKLQPLDFKENPEQSRVTINNWVANKTEGRIKDVIPQGAINELTALVLVNTI 252

  Fly   173 FFNLSWERTFNPEATYPREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVL-VPFSHGDLRML 236
            :|...|:..|:||.|....|.....:|..:|||:::.||.:..:.  :.|.|| :||...|:.|:
Mouse   253 YFKGLWKSKFSPENTRKEPFYKVDGQSCPVPMMYQEGKFKYRRVA--EGTQVLELPFKGDDITMV 315

  Fly   237 LIKPDQPDGLAALQMKLQAMNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPS 301
            ||.|.....||.::.:|....:......|:...:.|.:|:|:......|....:.||:.|:|.|.
Mouse   316 LILPKPEKSLAKVEQELTPELLQEWLDELSETMLVVHMPRFRTEDGFSLKEQLQDMGLIDLFSPE 380

  Fly   302 KSFSTLLHRNTNFRIDGVI-------------HVVTFEFQEQGI-GTPSTDVGNGSLTHTFNGVK 352
            ||           ::.|::             |....|..|:|. ...||.|.....:...|.|.
Mouse   381 KS-----------QLPGIVAGGRDDLYVSDAFHKAFLEVNEEGSEAAASTSVVITGRSLNPNRVT 434

  Fly   353 YFLATHPFAFYIID---NTSIYFAGHVTS 378
             |.|..||...|.:   || |.|.|.|.:
Mouse   435 -FKANRPFLVLIREVALNT-IIFMGRVAN 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 89/406 (22%)
Serpinc1NP_543120.1 serpinC1_AT3 71..464 CDD:381002 92/419 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.