DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpinb7

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_081824.1 Gene:Serpinb7 / 116872 MGIID:2151053 Length:380 Species:Mus musculus


Alignment Length:391 Identity:89/391 - (22%)
Similarity:168/391 - (42%) Gaps:46/391 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AQKNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHY----RGTHL 76
            |..|::...:|:..:.:|..|.|:.||:..|.:::..|.:|...|.:.||.||:|:    |..:.
Mouse     5 AAANAEFGFDLFREMDSSQGNGNVFFSSLSIFTALTLIRLGARGDCARQIDKALHFNIPSRQGNS 69

  Fly    77 SEYKPKTQ--------------KIFAMSVKKAPVAKSLTRF---YVR--QNMKMSTEYRVFMRHT 122
            |..:|..|              |.:.:|:.....|:.:..|   |:.  :|:            .
Mouse    70 SNNQPGLQYQLKRVLADINSSHKDYELSIATGVFAEKVYDFHKNYIECAENL------------Y 122

  Fly   123 EGRARNIAFAREQLD---EVNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNP 184
            ..:...:.|..:..|   ::|.:..:|...:|.:|:.:|....::..:||||::|...|:..|..
Mouse   123 NAKVERVDFTNDVQDTRFKINKWIENETHGKIKKVLGDSSLSSSAVMVLVNAVYFKGKWKSAFTK 187

  Fly   185 EATYPREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAAL 249
            ..|....||.......::.|||::.:|....:.......:.:.: ||.:.|.::.|:  |||..:
Mouse   188 TDTLSCRFRSPTCPGKVVNMMHQERRFNLSTIQQPPMQVLELQY-HGGISMYIMLPE--DGLCEI 249

  Fly   250 QMKLQAMNILSVARNLTMMDVFVGI--PKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNT 312
            :.||...|::.......|...:|.:  |:|||..:.|::...:.:|:||||..|.:..:.:....
Mouse   250 ESKLSFQNLMDWTNRRKMKSQYVNVFLPQFKIEKNYEMTHHLKSLGLKDIFDESSADLSGIASGG 314

  Fly   313 NFRIDGVIHVVTFEFQEQGI-GTPSTDVGNGSLTHTFNGVKYFLATHPFAFYIIDNTSIYFAGHV 376
            ...:..::|....|..|:|. .|.:|:  |..:.........|.|..||.|.|..|..|.|.|.|
Mouse   315 RLYVSKLMHKSFIEVSEEGTEATAATE--NNIVEKQLPESTVFRADRPFLFVIKKNDIILFTGKV 377

  Fly   377 T 377
            :
Mouse   378 S 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 86/379 (23%)
Serpinb7NP_081824.1 SERPIN 4..380 CDD:294093 89/391 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.