DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpinb5

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_476449.2 Gene:Serpinb5 / 116589 RGDID:69342 Length:375 Species:Rattus norvegicus


Alignment Length:397 Identity:93/397 - (23%)
Similarity:165/397 - (41%) Gaps:67/397 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEYKPKT 83
            ||....||:..:.......||:||...:.:|:....||.:.|.:.:|.:.:|:.           
  Rat     8 NSAFAVELFKQLCEKEPAGNILFSPICLSTSLSLAQVGAKGDTANEIGQVLHFE----------- 61

  Fly    84 QKIFAMSVKKAPVA-----------------KSLTRFYVRQNMKMSTEY-----RVFMRHTEGRA 126
                  :||..|..                 |.:.|.|:.:::.:|||:     |.:....|   
  Rat    62 ------NVKDVPFGFQTITSDVNKLSSFYSLKLIKRLYIDKSLNLSTEFISSTKRPYANELE--- 117

  Fly   127 RNIAFAREQLDE----VNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEAT 187
             .:.| :::|:|    :|:............::.|:.....::.|:|||.:|...|.:.|....|
  Rat   118 -TVDF-KDKLEETKGQINSSIKELTDGHFEDILPENSISDQTKILVVNAAYFVGKWMKKFPESET 180

  Fly   188 YPREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKP----DQPDGLAA 248
            ....||:|.|.:..:.||:.::.|..|.:.::....:.:||.:..|.||::.|    |:..||..
  Rat   181 KECPFRINKTDTKPVQMMNLEATFCLGNIDDINCKIIELPFQNKHLSMLIVLPKDVEDESTGLEK 245

  Fly   249 LQMKLQAMNILSVARNLTMMD--VFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRN 311
            ::.:|....:|......||.:  |.:.:||||:...::...:.|.:|:|.:|..|.|..:.:...
  Rat   246 IEKQLNPETLLQWTNPSTMANAKVKLSLPKFKVEKMIDPKASLESLGLKSLFNESTSDFSGMSET 310

  Fly   312 TNFRIDGVIHVVTFEFQEQG---IGTPSTDVGNGSLTHTFNGVKYFLATHPFAFYIIDN--TSIY 371
            ....:..|||.|..|..|.|   |..|    |:..|.|.    ..|.|.|||.|.:..|  .:|.
  Rat   311 KGVSVSNVIHRVCLEITEDGGDSIEVP----GSRILQHK----DEFKADHPFLFIVRHNKTRNIV 367

  Fly   372 FAGHVTS 378
            |.|..:|
  Rat   368 FLGKFSS 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 90/387 (23%)
Serpinb5NP_476449.2 serpinB5_maspin 1..375 CDD:381013 93/397 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.