DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and LOC100909605

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:XP_006240581.2 Gene:LOC100909605 / 100909605 RGDID:6502633 Length:410 Species:Rattus norvegicus


Alignment Length:422 Identity:89/422 - (21%)
Similarity:164/422 - (38%) Gaps:118/422 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSE----- 78
            |:.....||..:|....::||:||:..|.::::.:.:|.:.:..::|.:.:.:..|...|     
  Rat    41 NTDFAFSLYKELVLKNPDKNIVFSSFSISTALVLLSLGAKNNTLKEILEGLKFNLTETPEAEIHQ 105

  Fly    79 -YKPKTQKI------FAMSVKKAPVAKSLTRFYVRQNMKMSTEYRVFMRHTEGRARNIAFAREQL 136
             |:...|::      ..:|...|        .::::::::..|:       :.:||    |..|.
  Rat   106 GYEHLLQRLNLPGDQVQISTGSA--------LFIKKHLQILAEF-------QEKAR----ALYQA 151

  Fly   137 DEVNTFYS--HEMGEQIGQVVKESWWKPNSQG---------------LLVNAIFFNLSWERTFNP 184
            :..:|.:.  ||..:.|...|::     .:||               :|||.|:|...|:..|:|
  Rat   152 EAFSTDFQQPHEAKKLINDYVRK-----QTQGKIKELISVLDKKTSMVLVNYIYFKGKWKMPFDP 211

  Fly   185 EATYPREFRVNATKSVMIPMM---------HEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKP 240
            ..|:..||.::..|||.:|||         ..|.:.:..:| .||.|        |:...|.|.|
  Rat   212 HDTFQSEFYLDEKKSVKVPMMKIEKLTTPYFRDEELSCSVL-ELKYT--------GNASALFILP 267

  Fly   241 D-----------QPDGLAALQMKLQAMNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGI 294
            |           ||:.|...:..|:...|..:.           :|||.|.:|:.|.....::||
  Rat   268 DQGRMQQVEASLQPETLRRWKDTLRPRRIDELR-----------MPKFSISTDMRLGDILPELGI 321

  Fly   295 KDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFEFQEQGIGTPSTDVGNGSLTHTFNGVK------- 352
            :::|......|.:.... :..:..|:|....:..|.|....:.           .|||       
  Rat   322 REVFSQQADLSRITGAK-DLSVSQVVHKAVLDVTETGTEAAAA-----------TGVKIIPMCAK 374

  Fly   353 -YFLATH---PFAFYIID-NTSI-YFAGHVTS 378
             |::..:   ||...|.| ||.| .|...||:
  Rat   375 FYYVTMYFNRPFLMIISDTNTHIALFMAKVTN 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 86/412 (21%)
LOC100909605XP_006240581.2 alpha-1-antitrypsin_like 41..404 CDD:239011 87/418 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.