DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15611 and arhgef4

DIOPT Version :10

Sequence 1:NP_611189.2 Gene:CG15611 / 36930 FlyBaseID:FBgn0034194 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_004917856.1 Gene:arhgef4 / 100487089 XenbaseID:XB-GENE-960463 Length:1808 Species:Xenopus tropicalis


Alignment Length:341 Identity:78/341 - (22%)
Similarity:148/341 - (43%) Gaps:67/341 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 IIDELIQTEVNYVNNLKKGMLNYGQLKDVEDLPEALSGETKQKMLLGNIKEILELHEKEILPLML 232
            :|:|::.||.:|:.:||.  :..|.:|......:..: |.:...:.|||:||.:..:|.:..|..
 Frog  1404 VINEILNTEKHYIKHLKD--ICEGYIKQCRKRDDMFT-EDQLWTIFGNIEEIYKFQKKFLKTLEK 1465

  Fly   233 RNQRD------LKGLFDEFAAHFEKNSFYC---------YVSFTMGKKSSMQLRQDNRLWLQTYQ 282
            |..:|      :...|.|:...|:..|.||         ....|..||           ::..::
 Frog  1466 RINKDSPHLSEIGSCFLEYQTDFQIYSEYCNNHPNACTELSKLTKVKK-----------YVHFFE 1519

  Fly   283 T----QIKDKLGIDSFLVQPIQRLTRYPLLLQQ---FISEFYKSGISCKPVLTA---VCKLETRM 337
            |    |....:.:|.||:.|:|::.:|||.|.:   :.:..::...:.:..|.|   |.:|....
 Frog  1520 TCRLLQKMIDISLDGFLLTPVQKICKYPLQLAELLKYTNSQHRDYTNVEAALDAMKNVARLINER 1584

  Fly   338 RRALDVVNQ-AEEIPNIEELNELDVLQLGNFRRATEF-------DAQHFPTRKKYRSKVFLFDRC 394
            :|.|:.::: |....:||:....|:|     .|::|.       ...|...:.:.|. .||||..
 Frog  1585 KRRLENIDKIAHWQSSIEDWEGEDIL-----ARSSELIHSGELTKISHLQPKGQQRI-FFLFDHQ 1643

  Fly   395 LV-CTE--VRKKRLAYRQHYNWEHVELQRPLDSVSSNANKIINLLVKQE---EGGSSVGSKREEY 453
            :| |.:  :|:..|.|:...:.:.:|:.    :|....:|..|:.||..   :|..|    .|.:
 Frog  1644 IVFCKKDLLRRDILYYKGKIDMDDMEVL----NVEDGKDKDFNITVKNAFKLQGKVS----EEIH 1700

  Fly   454 SFMAAEASVVKQWLQA 469
            .|:|.:....::||||
 Frog  1701 LFLAKKPEHKQRWLQA 1716

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15611NP_611189.2 RhoGEF 167..313 CDD:470622 39/166 (23%)
arhgef4XP_004917856.1 SH3_ASEF 1291..1363 CDD:212906
RhoGEF 1404..1583 CDD:214619 43/192 (22%)
PH_Collybistin_ASEF 1588..1727 CDD:269931 34/143 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.