DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30456 and Plekhg4

DIOPT Version :9

Sequence 1:NP_611188.3 Gene:CG30456 / 36929 FlyBaseID:FBgn0050456 Length:682 Species:Drosophila melanogaster
Sequence 2:XP_038954139.1 Gene:Plekhg4 / 307796 RGDID:1310790 Length:1231 Species:Rattus norvegicus


Alignment Length:490 Identity:117/490 - (23%)
Similarity:199/490 - (40%) Gaps:121/490 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 ISADQSKEALTLPLKMRNDFPRNYRSTP--------RRKTEIIGTTNEHL---VGKFHSVYQPKD 306
            ::.||.:||...|..|.:......|..|        |:.........:||   ..:.|......|
  Rat   653 LALDQKREAALKPQSMNSTATLYVRRAPAIPTIPPLRKSYSFDQNLGKHLGDASNRGHCAATVTD 717

  Fly   307 -EEEEVEIELRDKSDKCV--------------HPILEELIKTEEAYVNNLFTGIENYGNIFQRKD 356
             ...|....:|.:|...|              ..:|.|::.||..||..|...|:||.....|.|
  Rat   718 CHRPEARGGIRPRSSPSVPLSGSSDFRSPNRLQLVLAEMVATEREYVRALDYTIQNYFPELDRSD 782

  Fly   357 LPLGLRGKKYDLFGNIEQIAEFHRDEFLPMLQRNRRDLKRLFDEFLQFLDQHCFYGYVIFTMNKQ 421
            :|.||||::..||||:|::.:||...||..|:...|...|:...||:...|  |..|.:::.||.
  Rat   783 VPQGLRGQRAHLFGNLEKLRDFHFHFFLRELEACTRHPPRVAHAFLRHRVQ--FGMYALYSKNKP 845

  Fly   422 KSLKLCDLY-KNYFTSIRLERDDKLGINSFLVQPIQRMARYPLLLTQFINTFFKNRDIVMKPLIE 485
            :|..|...| ..:|...:....|.|.:.|:|::|||||::|.|||.:               |..
  Rat   846 RSDALMSNYGHTFFKEKQQALGDHLDLASYLLKPIQRMSKYALLLQE---------------LAR 895

  Fly   486 SCCRLEKRLRAL----------LTTTNESEIINDIVDCHEFNVYYQGKFRKVNEFQVL--DHKLK 538
            :|....:.|.||          |...|:...::.|..| :.|:..||:..:.:||.|.  .||..
  Rat   896 ACGGPAQELGALQAAQSLVHFQLRHGNDLLAMDAIQGC-DVNLKEQGQLVRQDEFTVRAGHHKSC 959

  Fly   539 RSYRSKVFIFDKCIIYTEIK----GKNLLFHGR-YPCEHIGIS---AKTK-SFTLYYERRKQQEC 594
            |    :||:|::.:::::.:    |.::..:.| :....:|::   .::| .|.:::.|||.::.
  Rat   960 R----RVFLFEELLLFSKPRRGPAGVDIFTYKRSFKMADLGLTECCGESKLRFEIWFRRRKARDL 1020

  Fly   595 ------------EFTADPVQIAIWLDLIRDMINNYANEERQKLQERYSRENDHLHRKAPSFSLYR 647
                        .:||| :...:|    |..::|    :..::.|..|                 
  Rat  1021 FVLQASDVATKQAWTAD-ISRLLW----RQAVHN----KEVRMAEMAS----------------- 1059

  Fly   648 DSNRFSSDSGIGN--IW-IMPKADEDTISNRTTWY 679
                    .|:||  .| |.|  .|:.|::|...|
  Rat  1060 --------MGVGNKAFWDIAP--SEEAINDRNINY 1084

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30456NP_611188.3 RhoGEF 326..470 CDD:279015 53/144 (37%)
Plekhg4XP_038954139.1 SPEC 463..>614 CDD:413338
RhoGEF 749..915 CDD:238091 58/182 (32%)
PH_puratrophin-1 915..1050 CDD:270062 30/148 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.