DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and URE2

DIOPT Version :10

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_014170.1 Gene:URE2 / 855492 SGDID:S000005173 Length:354 Species:Saccharomyces cerevisiae


Alignment Length:49 Identity:14/49 - (28%)
Similarity:19/49 - (38%) Gaps:16/49 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 KLTWADVYFA---GITDYMNYMVKRDLLEPY-------------PALRG 227
            |||.||:.|.   .:.|.:...:|.:..|.|             .||||
Yeast   305 KLTIADLAFVPWNNVVDRIGINIKIEFPEVYKWTKHMMRRPAVIKALRG 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337
GST_C_Sigma_like 129..232 CDD:198301 14/49 (29%)
URE2NP_014170.1 GST_N_Ure2p_like 114..194 CDD:239346
GST_C_Ure2p 208..350 CDD:198326 10/44 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.