DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and AT1G57720

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001031202.1 Gene:AT1G57720 / 842147 AraportID:AT1G57720 Length:413 Species:Arabidopsis thaliana


Alignment Length:192 Identity:42/192 - (21%)
Similarity:72/192 - (37%) Gaps:61/192 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 APPAEGAPPA-EGEAPPPAEGAEGAVEGGEAAPPAEPAEPIKHSYTLFYFNVKALAEPLRYLFAY 70
            |...|..||. ..:||.||:..|   |..:|||.||..:|.:                       
plant   206 AKQTEAVPPVPTKKAPQPAKPKE---EPKKAAPVAEAPKPAE----------------------- 244

  Fly    71 GNQEYEDVRVTRDEWPALKPTMPMGQMP----VLEVDGKRVHQSISMARFLAKTVGLCGATPWED 131
                       .:|.|..|...|:..:|    ||: |.||:: |.:.:.|  :.|.:.|.  |:.
plant   245 -----------EEEAPKPKAKNPLDLLPPSPMVLD-DWKRLY-SNTKSNF--REVAIKGF--WDM 292

  Fly   132 LQIDIVVDTINDFRLSSEQFVSYEPEDEIKEKKLVTLNAEVIPFYLEKLEQTVKDNDGHLAL 193
            ...:.......|::.:.|..||:           ||||.  :..:|::::...|.:.|.:.:
plant   293 YDPEGYSLWFCDYKYNDENMVSF-----------VTLNK--VGGFLQRMDLARKYSFGKMLI 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 12/72 (17%)
PTZ00057 52..245 CDD:173353 26/146 (18%)
GST_C_Sigma_like 129..232 CDD:198301 12/65 (18%)
AT1G57720NP_001031202.1 GST_N_EF1Bgamma 6..77 CDD:239342
GstA 16..202 CDD:223698
GST_C_EF1Bgamma_like 90..210 CDD:198290 1/3 (33%)
EF1G 255..360 CDD:279041 23/106 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.