DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and GSTF14

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_175408.1 Gene:GSTF14 / 841409 AraportID:AT1G49860 Length:254 Species:Arabidopsis thaliana


Alignment Length:229 Identity:51/229 - (22%)
Similarity:89/229 - (38%) Gaps:66/229 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 HSYTLFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPA--------LKPTMPMGQMPVLEVDG 104
            :|..||..|.|.|             ::|.|.|   :|.|        |....|.|::||||...
plant    16 NSAALFCINEKGL-------------DFELVFV---DWLAGEAKTKTFLSTLNPFGEVPVLEDGD 64

  Fly   105 KRVHQSISMARFLA---KTVG--LCGATP--------WEDLQ----IDIVVDTINDFRLSSEQFV 152
            .::.:..::.|:||   |.||  |....|        |.::.    :.|....|.:..::..|.:
plant    65 LKLFEPKAITRYLAEQYKDVGTNLLPDDPKKRAIMSMWMEVDSNQFLPIASTLIKELIINPYQGL 129

  Fly   153 SYEPE--DEIKEKKLVTLNAEVIPFYLEKLEQTVKDNDGHLALGKLTWADVYFAGITDYMNYMVK 215
            :.:..  .|.|||.     :||:..|..:|.::     .:||....:.||::.....||:....:
plant   130 ATDDTAVQENKEKL-----SEVLNIYETRLGES-----PYLAGESFSLADLHHLAPIDYLLNTDE 184

  Fly   216 RDLLEPYPALRGVVDAVNALEPIKAWIEK---RP 246
            .:|          .:.:.:...:.||:||   ||
plant   185 EEL----------KNLIYSRPNVAAWVEKMKMRP 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 20/79 (25%)
PTZ00057 52..245 CDD:173353 48/222 (22%)
GST_C_Sigma_like 129..232 CDD:198301 19/108 (18%)
GSTF14NP_175408.1 GST_N_Phi 5..80 CDD:239351 21/79 (27%)
GST_C_Phi 94..214 CDD:198296 25/135 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.