DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and GSTT1

DIOPT Version :10

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_198937.1 Gene:GSTT1 / 834123 AraportID:AT5G41210 Length:245 Species:Arabidopsis thaliana


Alignment Length:67 Identity:14/67 - (20%)
Similarity:38/67 - (56%) Gaps:9/67 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LAEPLRYLFAY---GNQEYEDVRVT---RDEW-PALKPTMPMGQMPVLEVDGK-RVHQSISMARF 116
            :::|.|.:..:   ...::::|.::   |.:. |..|...|:|::|.: |||: ::.:|.::..:
plant    11 MSQPSRAVIIFCKVNGIQFDEVLISLAKRQQLSPEFKDINPLGKVPAI-VDGRLKLFESHAILIY 74

  Fly   117 LA 118
            |:
plant    75 LS 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 14/67 (21%)
GST_C_Sigma_like 129..232 CDD:198301
GSTT1NP_198937.1 GST_N_Theta 4..79 CDD:239348 14/67 (21%)
GST_C_Theta 93..223 CDD:198292
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.