DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and ATGSTF13

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_191835.1 Gene:ATGSTF13 / 825451 AraportID:AT3G62760 Length:219 Species:Arabidopsis thaliana


Alignment Length:208 Identity:44/208 - (21%)
Similarity:74/208 - (35%) Gaps:62/208 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 NQEYEDVRVT----RDEWPALKPTMPMGQMPVLEVDGKRVHQSISMARFLAK------------- 119
            |.|:|.|.|.    ..:.|:.....|.|::|.|:.|...:.:|.::..::|:             
plant    25 NTEFELVPVNLFACHHKLPSFLSMNPFGKVPALQDDDLTLFESRAITAYIAEKHRDKGTDLTRHE 89

  Fly   120 ------TVGLCGATPWEDLQ-------IDIVVDTINDFRLSSEQFVSYEPEDEIKEKKLVTLNAE 171
                  .|.|     |.:::       |..|:..:....|..|     .|...|.|:.|..| .:
plant    90 DPKEAAIVKL-----WSEVEAHHFNPAISAVIHQLIVVPLQGE-----SPNAAIVEENLENL-GK 143

  Fly   172 VIPFYLEKLEQTVKDNDGHLALGKLTWADVYFAGITDYMNYMVKRDLLEPYPALRGVVDAVNALE 236
            ::..|.|:|.:|     .:||....|.||::....|.|....:...|:...|             
plant   144 ILDVYEERLGKT-----KYLAGDTYTLADLHHVPYTYYFMKTIHAGLINDRP------------- 190

  Fly   237 PIKAWIE---KRP 246
            .:|||.|   .||
plant   191 NVKAWWEDLCSRP 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 12/50 (24%)
PTZ00057 52..245 CDD:173353 42/205 (20%)
GST_C_Sigma_like 129..232 CDD:198301 23/109 (21%)
ATGSTF13NP_191835.1 PLN02395 1..209 CDD:166036 44/208 (21%)
GST_N_Phi 2..77 CDD:239351 13/51 (25%)
GST_C_Phi 92..208 CDD:198296 31/141 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.