Sequence 1: | NP_001261040.1 | Gene: | GstS1 / 36927 | FlyBaseID: | FBgn0010226 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_191835.1 | Gene: | ATGSTF13 / 825451 | AraportID: | AT3G62760 | Length: | 219 | Species: | Arabidopsis thaliana |
Alignment Length: | 208 | Identity: | 44/208 - (21%) |
---|---|---|---|
Similarity: | 74/208 - (35%) | Gaps: | 62/208 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 72 NQEYEDVRVT----RDEWPALKPTMPMGQMPVLEVDGKRVHQSISMARFLAK------------- 119
Fly 120 ------TVGLCGATPWEDLQ-------IDIVVDTINDFRLSSEQFVSYEPEDEIKEKKLVTLNAE 171
Fly 172 VIPFYLEKLEQTVKDNDGHLALGKLTWADVYFAGITDYMNYMVKRDLLEPYPALRGVVDAVNALE 236
Fly 237 PIKAWIE---KRP 246 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstS1 | NP_001261040.1 | GST_N_Sigma_like | 50..119 | CDD:239337 | 12/50 (24%) |
PTZ00057 | 52..245 | CDD:173353 | 42/205 (20%) | ||
GST_C_Sigma_like | 129..232 | CDD:198301 | 23/109 (21%) | ||
ATGSTF13 | NP_191835.1 | PLN02395 | 1..209 | CDD:166036 | 44/208 (21%) |
GST_N_Phi | 2..77 | CDD:239351 | 13/51 (25%) | ||
GST_C_Phi | 92..208 | CDD:198296 | 31/141 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X30 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |