DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and GSTF11

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_186969.1 Gene:GSTF11 / 821227 AraportID:AT3G03190 Length:214 Species:Arabidopsis thaliana


Alignment Length:226 Identity:51/226 - (22%)
Similarity:87/226 - (38%) Gaps:61/226 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 YFNVKALAEPLRYLFAYGNQ--EYEDVRVTRDEWPALKP----TMPMGQMPVLEVDGKRVHQSIS 112
            |..:|| |.|.|.|..:..:  |:|.:.|..|:....||    ..|.||:|.:|....::.:|.:
plant     6 YGQIKA-ANPQRVLLCFLEKDIEFEVIHVDLDKLEQKKPQHLLRQPFGQVPAIEDGYLKLFESRA 69

  Fly   113 MARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVSYE---------------------- 155
            :||:.        ||.:.|...|::..|: :.|...:|:|..|                      
plant    70 IARYY--------ATKYADQGTDLLGKTL-EGRAIVDQWVEVENNYFYAVALPLVMNVVFKPKSG 125

  Fly   156 -PEDEIKEKKLVTLNAEVIPFYLEKLEQTVKDNDGHLALGKLTWADV-YFAGITDYMNYMVKRDL 218
             |.|....::|.....:|:..|..:|.     .:.:|...:.|.||: :..|:...||       
plant   126 KPCDVALVEELKVKFDKVLDVYENRLA-----TNRYLGGDEFTLADLSHMPGMRYIMN------- 178

  Fly   219 LEPYPALRGVVDAVNALEPIKAW---IEKRP 246
               ..:|.|:   |.:.|.:..|   |..||
plant   179 ---ETSLSGL---VTSRENLNRWWNEISARP 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 21/70 (30%)
PTZ00057 52..245 CDD:173353 49/223 (22%)
GST_C_Sigma_like 129..232 CDD:198301 22/126 (17%)
GSTF11NP_186969.1 PLN02473 1..214 CDD:166114 51/226 (23%)
GST_N_Phi 2..77 CDD:239351 22/79 (28%)
GST_C_Phi 91..209 CDD:198296 25/131 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.