DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and Gstm7

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_112416.1 Gene:Gstm7 / 81869 RGDID:621287 Length:218 Species:Rattus norvegicus


Alignment Length:226 Identity:58/226 - (25%)
Similarity:102/226 - (45%) Gaps:50/226 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TLFYFNVKALAEPLRYLFAYGNQEYEDVRVT--------RDEWPALKPTMPMG----QMPVLEVD 103
            ||.|::::.||..:|.|..|.:..||:.|.|        |.:|  |.....:|    .:|.| :|
  Rat     4 TLGYWDIRGLAHAIRLLLEYTDSSYEEKRYTMGDAPDFDRSQW--LNEKFKLGLDFPNLPYL-ID 65

  Fly   104 GK-RVHQSISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVSYEPEDEIKEKKLVT 167
            |. ::.||.::.|:|.:...|||.|..|.:::||:.:.:.|.|:...: :.|.|:.|        
  Rat    66 GSHKITQSNAILRYLGRKHNLCGETEEERIRVDILENQLMDNRMVLAR-LCYNPDFE-------- 121

  Fly   168 LNAEVIPFYLEKLEQTVKDNDGHLALGKLTWADVYFAG----ITDYMNYMV-------KRDLLEP 221
               ::.|.|||:|...::.....  |||..|    |||    ..|::.|.|       :...|:.
  Rat   122 ---KLKPGYLEQLPGMMRLYSEF--LGKRPW----FAGDKITFVDFIAYDVLERNQVFEATCLDA 177

  Fly   222 YPALRGVVDAVNALEPIKAWIEK-----RPV 247
            :|.|:..:.....|:.|..:::.     ||:
  Rat   178 FPNLKDFIARFEGLKKISDYMKSSRFLPRPL 208

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 24/80 (30%)
PTZ00057 52..245 CDD:173353 55/221 (25%)
GST_C_Sigma_like 129..232 CDD:198301 26/113 (23%)
Gstm7NP_112416.1 GstA 3..189 CDD:223698 54/205 (26%)
GST_N_Mu 3..84 CDD:239373 24/82 (29%)