DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and gstp1

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_571809.1 Gene:gstp1 / 79381 ZFINID:ZDB-GENE-020806-4 Length:208 Species:Danio rerio


Alignment Length:212 Identity:63/212 - (29%)
Similarity:99/212 - (46%) Gaps:27/212 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YTLFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPA--LKPTMPMGQMPVLEVDGKRV-HQSI 111
            |||.||.||.....|:.:.|..:|:.::..||.:||..  ||.|...||:|..| ||..| .||.
Zfish     4 YTLTYFAVKGRCGALKIMLADKDQQLKENLVTFEEWMKGDLKATCVFGQLPKFE-DGDLVLFQSN 67

  Fly   112 SMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFV--SYEPEDE--IKEKKLVTLNAEV 172
            :|.|.|.:.....|....|...||::.|.:.|.||...:.:  .||...|  ||:          
Zfish    68 AMLRHLGRKHAAYGKNDSEASLIDVMNDGVEDLRLKYIKLIYQEYETGKEAFIKD---------- 122

  Fly   173 IPFYLEKLEQTV-KDNDGHLALGKLTWADVYFAGITDYMNYMV-KRDLLEPYPALRGVVDAVNAL 235
            :|.:|:..|..: |:..|.|...::::||.....:  .:|..| ....|:.:|:|:..||.::|.
Zfish   123 LPNHLKCFENVLAKNKTGFLVGDQISFADYNLFDL--LLNLKVLSPSCLDSFPSLKSFVDKISAR 185

  Fly   236 EPIKAWIE-----KRPV 247
            ..:||.:|     |.|:
Zfish   186 PKVKALLECENFKKLPI 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 29/71 (41%)
PTZ00057 52..245 CDD:173353 59/206 (29%)
GST_C_Sigma_like 129..232 CDD:198301 27/108 (25%)
gstp1NP_571809.1 GST_N_Pi 3..76 CDD:239374 29/72 (40%)
PTZ00057 6..189 CDD:173353 56/195 (29%)
GST_C_Pi 84..208 CDD:198319 33/131 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I5314
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24317
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.