DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and Gstm7

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_006502034.1 Gene:Gstm7 / 68312 MGIID:1915562 Length:225 Species:Mus musculus


Alignment Length:206 Identity:48/206 - (23%)
Similarity:86/206 - (41%) Gaps:41/206 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LAEPLRYLFAYGNQEYEDVRVTRDEWP----------ALKPTMPMGQMPVLEVDGK-RVHQSISM 113
            ||..:|....|.:..||:.|.|..:.|          ..|..:....:|.| :||. ::.||.::
Mouse    20 LAHAIRLFLEYTDSSYEEKRYTMGDAPDYDQSQWLNEKFKLGLDFPNLPYL-IDGSHKITQSNAI 83

  Fly   114 ARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVSYEPEDEIKEKKLVTLNAEVIPFYLE 178
            .|:|.:...|||.|..|.:::||:.:.:.|.|:...:.......:::|            |.|||
Mouse    84 LRYLGRKHNLCGETEEERIRVDILENQLMDNRMVLARLCYNADFEKLK------------PGYLE 136

  Fly   179 KLEQTVKDNDGHLALGKLTWADVYFAG----ITDYMNYMV-------KRDLLEPYPALRGVVDAV 232
            :|...::.....  |||..|    |||    ..|::.|.|       :...|:.:|.|:..:...
Mouse   137 QLPGMMRLYSEF--LGKRPW----FAGDKITFVDFIAYDVLERNQVFEAKCLDAFPNLKDFIARF 195

  Fly   233 NALEPIKAWIE 243
            ..|:.|..:::
Mouse   196 EGLKKISDYMK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 18/69 (26%)
PTZ00057 52..245 CDD:173353 48/206 (23%)
GST_C_Sigma_like 129..232 CDD:198301 24/113 (21%)
Gstm7XP_006502034.1 GST_N_Mu 20..91 CDD:239373 18/71 (25%)
GST_C_Mu 99..219 CDD:198318 26/126 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.