DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and Hpgds

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_006236664.1 Gene:Hpgds / 58962 RGDID:69251 Length:200 Species:Rattus norvegicus


Alignment Length:202 Identity:80/202 - (39%)
Similarity:121/202 - (59%) Gaps:4/202 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SYTLFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLEVDGKRVHQSISM 113
            :|.|.|||::..||.:||:|||.:.:|||.|:.:.:||.:|||:|.|::|||||:|..:|||:::
  Rat     3 NYKLLYFNMRGRAEIIRYIFAYLDIKYEDHRIEQADWPKIKPTLPFGKIPVLEVEGLTLHQSLAI 67

  Fly   114 ARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVSYEPEDEIKEKKLVTLNAEVIPFYLE 178
            ||:|.|...|.|.|..|..|:|.||||::||   ...|...|...::||:....|.....|..|:
  Rat    68 ARYLTKNTDLAGKTELEQCQVDAVVDTLDDF---MSLFPWAEENQDLKERTFNDLLTRQAPHLLK 129

  Fly   179 KLEQTVKDNDGHLALGKLTWADVYFAGITDYMNYMVKRDLLEPYPALRGVVDAVNALEPIKAWIE 243
            .|:..:.|.:..:...::||||.|: .|......::|.|||..||.|..:.:.|.|:..|.|||.
  Rat   130 DLDTYLGDKEWFIGNYQVTWADFYW-DICSTTLLVLKPDLLGIYPRLVSLRNKVQAIPAISAWIL 193

  Fly   244 KRPVTEV 250
            |||.|::
  Rat   194 KRPQTKL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 35/68 (51%)
PTZ00057 52..245 CDD:173353 75/192 (39%)
GST_C_Sigma_like 129..232 CDD:198301 31/102 (30%)
HpgdsXP_006236664.1 PTZ00057 3..198 CDD:173353 79/198 (40%)
GST_N_Sigma_like 4..73 CDD:239337 35/68 (51%)
GST_C_Sigma 82..182 CDD:198328 31/103 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354086
Domainoid 1 1.000 82 1.000 Domainoid score I8275
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113741
Inparanoid 1 1.050 144 1.000 Inparanoid score I4365
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 1 1.000 - - FOG0000305
OrthoInspector 1 1.000 - - oto96186
orthoMCL 1 0.900 - - OOG6_100172
Panther 1 1.100 - - O PTHR11571
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.