DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and gstm.2

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001103586.1 Gene:gstm.2 / 571365 ZFINID:ZDB-GENE-080218-30 Length:219 Species:Danio rerio


Alignment Length:224 Identity:61/224 - (27%)
Similarity:96/224 - (42%) Gaps:49/224 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWP------------ALKPTMPMGQMPVLEVDG 104
            |.|::::.||:|:|.|..|...:||:...:..|.|            .||...|  .:|.||...
Zfish     5 LVYWDIRGLAQPIRLLLEYTGTKYEEKLYSCGEAPNYDRSCWLNDKSKLKMDFP--NLPYLEDGD 67

  Fly   105 KRVHQSISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVSYEPEDEIKEKKLVTLN 169
            :::.||.::.|::|:...|||.|..|.:::||:.:...|||....| :.|...|:.|..      
Zfish    68 RKIVQSNAIMRYIARKHNLCGETEEEQIRVDILENQAMDFRNGFVQ-LCYFDFDKNKSS------ 125

  Fly   170 AEVIPFYLEKLEQTVKDNDGHLALGKLTWADVYFAG----ITDYMNY-------MVKRDLLEPYP 223
                  |.|||..|:|.....  ||...|    |||    ..|::.|       |.:...|:.:.
Zfish   126 ------YCEKLPGTLKQFSDF--LGDRKW----FAGDKITFVDFIMYELLDQHRMFEPACLDDFK 178

  Fly   224 ALRGVVDAVNALEPIKAWIE-----KRPV 247
            .||..:|....||.|..:::     |.||
Zfish   179 NLRCFLDHFENLEKIAEYMKSNRFMKTPV 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 21/78 (27%)
PTZ00057 52..245 CDD:173353 58/220 (26%)
GST_C_Sigma_like 129..232 CDD:198301 29/113 (26%)
gstm.2NP_001103586.1 GST_N_Mu 3..84 CDD:239373 22/80 (28%)
GST_C_Mu 92..211 CDD:198318 35/135 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I5314
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24317
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3880
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.