Sequence 1: | NP_001261040.1 | Gene: | GstS1 / 36927 | FlyBaseID: | FBgn0010226 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018349.1 | Gene: | gstp2 / 553169 | ZFINID: | ZDB-GENE-050601-1 | Length: | 208 | Species: | Danio rerio |
Alignment Length: | 209 | Identity: | 61/209 - (29%) |
---|---|---|---|
Similarity: | 98/209 - (46%) | Gaps: | 21/209 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 50 YTLFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPA--LKPTMPMGQMPVLEVDGKRV-HQSI 111
Fly 112 SMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVS--YEPEDEIKEKKLVTLNAEVIP 174
Fly 175 FYLEKLEQTVKDNDGHLALGKLTWADVYFAGITDYMNYMV-KRDLLEPYPALRGVVDAVNALEPI 238
Fly 239 KAWIE-----KRPV 247 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstS1 | NP_001261040.1 | GST_N_Sigma_like | 50..119 | CDD:239337 | 27/71 (38%) |
PTZ00057 | 52..245 | CDD:173353 | 57/203 (28%) | ||
GST_C_Sigma_like | 129..232 | CDD:198301 | 26/105 (25%) | ||
gstp2 | NP_001018349.1 | GST_N_Pi | 3..76 | CDD:239374 | 27/72 (38%) |
PTZ00057 | 6..189 | CDD:173353 | 54/192 (28%) | ||
GST_C_Pi | 84..208 | CDD:198319 | 32/128 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 70 | 1.000 | Inparanoid score | I5314 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1162336at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | otm24317 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.970 |