DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and gsta4

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001016676.1 Gene:gsta4 / 549430 XenbaseID:XB-GENE-5835433 Length:233 Species:Xenopus tropicalis


Alignment Length:209 Identity:52/209 - (24%)
Similarity:109/209 - (52%) Gaps:23/209 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LFYFNVKALAEPLRYLFAYGNQEYEDVRV-TRDEWPAL--KPTMPMGQMPVLEVDGKRVHQSISM 113
            |.|||.:...|.:|:|.|....|:|:..: ||:::.||  ...:|..|:||:|:||.::.|:.::
 Frog     7 LHYFNGRGKMESIRWLLAAAGVEFEEEMIETREQFEALFQDGNLPFKQVPVVEMDGMKLVQTKAI 71

  Fly   114 ARFLAKTVGLCGATPWEDLQIDIVVDTINDFR--LSSEQFV-SYEPEDEIKEKKLVTLNAEVIPF 175
            .:::|....|.|....|.:.||:.|:...:|.  :.|:.|: :.||..:|   .::...|::.  
 Frog    72 LQYIAAKYNLYGKDIVERVLIDMYVEGTTEFMEVIMSQPFLQNVEPGMQI---DVLVQKAKMC-- 131

  Fly   176 YLEKLEQTVKDNDGHLALG-KLTWADVYFAGITDYMNYMVKR---DLLEPYPALRGVVDAVNALE 236
            ||...|:.::|:.....:| :.:|||:......    .|::.   ::|..:|.|:...:.::.:.
 Frog   132 YLPVYEKVLRDHGQDFLVGNQFSWADIQLLEAI----LMIEEKSANVLSNFPLLQDFKERISEIP 192

  Fly   237 PIKAWI----EKRP 246
            .|||::    :::|
 Frog   193 TIKAFLLPGSKRKP 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 22/69 (32%)
PTZ00057 52..245 CDD:173353 51/206 (25%)
GST_C_Sigma_like 129..232 CDD:198301 23/109 (21%)
gsta4NP_001016676.1 Thioredoxin_like 4..82 CDD:381987 23/74 (31%)
GST_C_Alpha 86..220 CDD:198317 27/130 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.