DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and gstp1

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001016641.1 Gene:gstp1 / 549395 XenbaseID:XB-GENE-5846243 Length:211 Species:Xenopus tropicalis


Alignment Length:215 Identity:59/215 - (27%)
Similarity:101/215 - (46%) Gaps:27/215 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YTLFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPA----LKPTMPMGQMPVLEVDGKRVHQS 110
            |||.||.|:..||.:|.|.|.....::|.......|.|    .|.....||:|..:.....::||
 Frog     4 YTLTYFPVRGRAEAIRLLLADQGVAFKDEEAQIPLWFAGKDDRKKHAVFGQLPQFKNGDYTLYQS 68

  Fly   111 ISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVSYEPEDEIKEKKLVTLNAEVIPF 175
            .|:.|:|.:..||.|:...|...||:|.|.:.|.|....:.: :...|..|:|.|     |.:|.
 Frog    69 NSILRYLGRKHGLNGSNDEELGHIDMVNDGVEDLRQKYVRLI-FTEYDTGKDKYL-----EALPQ 127

  Fly   176 YLEKLEQTV-KDNDG-HLALG-KLTWADVYFAGITDYMNYMVKRDL----LEPYPALRGVVDAVN 233
            .||..|:.: |:::| ...:| |:::||.   .:.|.::..:  ||    |..:|.|...|:.:|
 Frog   128 QLEFFERILSKNHNGSKFIVGQKISYADY---NLLDLLHCHL--DLSPKSLSAFPLLSAYVERLN 187

  Fly   234 ALEPIKAWIE-----KRPVT 248
            :...:..:::     :||:|
 Frog   188 SRPKLNEYLKSEARNRRPIT 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 23/72 (32%)
PTZ00057 52..245 CDD:173353 54/208 (26%)
GST_C_Sigma_like 129..232 CDD:198301 29/109 (27%)
gstp1NP_001016641.1 GST_N_Pi 3..78 CDD:239374 23/73 (32%)
GST_C_family 86..211 CDD:383119 33/133 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.