DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and Gstm6

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001102662.1 Gene:Gstm6 / 499688 RGDID:1563391 Length:218 Species:Rattus norvegicus


Alignment Length:215 Identity:53/215 - (24%)
Similarity:91/215 - (42%) Gaps:41/215 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TLFYFNVKALAEPLRYLFAYGNQEYEDVRVT--------RDEW--PALKPTMPMGQMPVLEVDGK 105
            ||.|::::.|...:|.|..|....||:.|..        |.:|  ...|..:....:|.| :||.
  Rat     4 TLGYWDIRGLGHAIRLLLEYTETSYEEKRYAMGDAPDYDRSQWLDDKFKLDLDFPNLPYL-IDGS 67

  Fly   106 -RVHQSISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVSYEPEDEIKEKKLVTLN 169
             :|.||.::.|:|.:...|||.|..|.:::||:...:.|.|:.... :.|.|:.|.::.:.:...
  Rat    68 HKVTQSNAILRYLGRKHNLCGETEEERIRVDILEKQVMDTRIQMGT-LCYSPDFEKRKPEFLKGL 131

  Fly   170 AEVIPFYLEKLEQTVKDNDGHLALGKLTWADVYFAG----ITDYMNY-------MVKRDLLEPYP 223
            .:.:..|.|             .|||..|    |||    ..|::.|       |.:...|:.:|
  Rat   132 PDQLKLYSE-------------FLGKQPW----FAGDKITFADFLVYDVLDQHRMFEPKCLDAFP 179

  Fly   224 ALRGVVDAVNALEPIKAWIE 243
            .|...|.....|:.|.|:::
  Rat   180 NLMDFVVHFEGLKKISAYMK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 22/78 (28%)
PTZ00057 52..245 CDD:173353 52/214 (24%)
GST_C_Sigma_like 129..232 CDD:198301 24/113 (21%)
Gstm6NP_001102662.1 PTZ00057 3..202 CDD:173353 53/215 (25%)
GST_N_Mu 3..84 CDD:239373 22/80 (28%)
GST_C_Mu 92..212 CDD:198318 27/126 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.