DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and gstt1

DIOPT Version :10

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001006811.1 Gene:gstt1 / 448525 XenbaseID:XB-GENE-998695 Length:242 Species:Xenopus tropicalis


Alignment Length:50 Identity:16/50 - (32%)
Similarity:21/50 - (42%) Gaps:21/50 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LAEPLR--YLFAYGN------------------QEYEDVRVTRDEWPALK 89
            |::|.|  |:||..|                  :||..|.|.| :.||||
 Frog    11 LSQPCRSVYIFAKANNIPFNNHQVRLFKGEHLTEEYGKVNVLR-KVPALK 59

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 15/49 (31%)
GST_C_Sigma_like 129..232 CDD:198301
gstt1NP_001006811.1 GST_N_Theta 4..79 CDD:239348 15/49 (31%)
GST_C_Theta 92..217 CDD:198292
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.