DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and gsta.1

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_998559.1 Gene:gsta.1 / 406703 ZFINID:ZDB-GENE-040426-2720 Length:223 Species:Danio rerio


Alignment Length:201 Identity:44/201 - (21%)
Similarity:94/201 - (46%) Gaps:19/201 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LFYFNVKALAEPLRYLFAYGNQEYEDVRVT-RDEWPAL--KPTMPMGQMPVLEVDGKRVHQSISM 113
            |.|||.:...|.:|:|.|....::|:|.:| ::::..|  ...:...|:|::|:||.::.||.::
Zfish     7 LHYFNGRGKMESIRWLLAVAGVQFEEVFLTEKEQFDKLLSDGALTFQQVPLVEIDGMKLVQSKAI 71

  Fly   114 ARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVSYEPEDEIKEKKLVTLNAE------V 172
            ..::|....|.|    :||:...::|..::..:...:.:...|....:.|:.|..|.|      .
Zfish    72 LNYIAGKYNLYG----KDLKERAMIDIYSEGLIDLMEMIMVSPFTPAENKEKVFSNIEEKAKVRF 132

  Fly   173 IPFYLEKLEQTVKDNDGHLALGKLTWADVYFAGITDYMNYMVKRDLLEPYPALRGVVDAVNALEP 237
            :|.:.:.|.     |...|...:|:.|||:....|..:..:.. .:|..:|.::...:.:.||..
Zfish   133 LPVFEKALA-----NSSFLVGKQLSRADVHLLEATLMLQELFP-SILATFPKIQAFQEQMKALPA 191

  Fly   238 IKAWIE 243
            |..:::
Zfish   192 ISKFLQ 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 19/69 (28%)
PTZ00057 52..245 CDD:173353 44/201 (22%)
GST_C_Sigma_like 129..232 CDD:198301 19/108 (18%)
gsta.1NP_998559.1 PTZ00057 1..196 CDD:173353 44/198 (22%)
Thioredoxin_like 4..82 CDD:294274 20/74 (27%)
GST_C_Alpha 86..218 CDD:198317 21/118 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24317
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3880
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.