DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and F55A11.11

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001370163.1 Gene:F55A11.11 / 3565838 WormBaseID:WBGene00010082 Length:314 Species:Caenorhabditis elegans


Alignment Length:148 Identity:32/148 - (21%)
Similarity:52/148 - (35%) Gaps:25/148 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LAEPLRYLFAYGNQEYEDVRVTRDEWPAL----KPTMPMGQMPVLEVDGKRVHQSISMARFLAKT 120
            |.||:.:....|.::..|......::|.:    ||...|.:...: ...|...|.|.....:.|.
 Worm   146 LLEPMEWYRRAGAKQLPDFFDEALDFPQVDKTYKPIFSMHEFTSM-FGAKSQEQCIQRIMLVVKN 209

  Fly   121 VGLC---GATPWEDLQIDIVVDTINDF-----RLSS---EQFVSYE----PEDEIKEKKLVTLNA 170
            :  |   ..||...:...:.:|..:..     .|||   |...|||    |.|...:...:.|..
 Worm   210 I--CVIFRDTPALIIGHAVTMDVASKIGQHGDMLSSGHTEDLTSYEDSTYPSDPSGQAAKLELGV 272

  Fly   171 EVIPFYLEKLEQTVKDND 188
            ...|..:..|   |::||
 Worm   273 RYPPLSVMGL---VRNND 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 12/62 (19%)
PTZ00057 52..245 CDD:173353 32/148 (22%)
GST_C_Sigma_like 129..232 CDD:198301 16/72 (22%)
F55A11.11NP_001370163.1 HP 87..>231 CDD:416258 17/87 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.