DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and GSTM5

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_000842.2 Gene:GSTM5 / 2949 HGNCID:4637 Length:218 Species:Homo sapiens


Alignment Length:218 Identity:57/218 - (26%)
Similarity:102/218 - (46%) Gaps:47/218 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TLFYFNVKALAEPLRYLFAYGNQEYEDVRVT--------RDEWPALKPTMPMG----QMPVLEVD 103
            ||.|::::.||..:|.|..|.:..|.:.:.|        |.:|  |.....:|    .:|.| :|
Human     4 TLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQW--LNEKFKLGLDFPNLPYL-ID 65

  Fly   104 G-KRVHQSISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVSYEPEDEIKEKKLVT 167
            | .::.||.::.|::|:...|||.|..|.:::||:.:.:.|..:...: :.|:|:.|        
Human    66 GAHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQVMDNHMELVR-LCYDPDFE-------- 121

  Fly   168 LNAEVIPFYLEKLEQTVKDNDGHLALGKLTWADVYFAG----ITDYMNYMV---KRDLLEP---- 221
               ::.|.|||:|.:.:|.....  |||..|    |||    ..|::.|.|   || :.||    
Human   122 ---KLKPKYLEELPEKLKLYSEF--LGKRPW----FAGDKITFVDFLAYDVLDMKR-IFEPKCLD 176

  Fly   222 -YPALRGVVDAVNALEPIKAWIE 243
             :..|:..:.....|:.|.|:::
Human   177 AFLNLKDFISRFEGLKKISAYMK 199

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 21/80 (26%)
PTZ00057 52..245 CDD:173353 56/217 (26%)
GST_C_Sigma_like 129..232 CDD:198301 28/114 (25%)
GSTM5NP_000842.2 GST_N_Mu 3..84 CDD:239373 22/82 (27%)