DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and GSTM4

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_016856574.1 Gene:GSTM4 / 2948 HGNCID:4636 Length:254 Species:Homo sapiens


Alignment Length:209 Identity:55/209 - (26%)
Similarity:94/209 - (44%) Gaps:53/209 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SYTLFYFNVKALAEPLRYLFAYGNQEYEDVRVT--------RDEWPALKPTMPMG----QMPVLE 101
            |.||.|::::.||..:|.|..|.:..||:.:.|        |.:|  |.....:|    .:|.| 
Human     2 SMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQW--LNEKFKLGLDFPNLPYL- 63

  Fly   102 VDG-KRVHQSISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQF--VSYEPEDEIKEK 163
            :|| .::.||.::..::|:...|||.|..|.:::||:.:...|.   |.|.  |.|.|:.|    
Human    64 IDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQAMDV---SNQLARVCYSPDFE---- 121

  Fly   164 KLVTLNAEVIPFYLEKLEQTVKDNDGHLA--LGKLTWADVYFAG----ITDYMNYMV-------K 215
                   ::.|.|||:|...::    |.:  |||..|    |.|    ..|::.|.|       :
Human   122 -------KLKPEYLEELPTMMQ----HFSQFLGKRPW----FVGDKITFVDFLAYDVLDLHRIFE 171

  Fly   216 RDLLEPYPALRGVV 229
            .:.|:.:|.|:..:
Human   172 PNCLDAFPNLKDFI 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 21/81 (26%)
PTZ00057 52..245 CDD:173353 53/206 (26%)
GST_C_Sigma_like 129..232 CDD:198301 28/116 (24%)
GSTM4XP_016856574.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3880
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.