DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and GSTM3

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_000840.2 Gene:GSTM3 / 2947 HGNCID:4635 Length:225 Species:Homo sapiens


Alignment Length:226 Identity:58/226 - (25%)
Similarity:107/226 - (47%) Gaps:46/226 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SYTLFYFNVKALAEPLRYLFAYGNQEYEDVRVT--------RDEWPALKPTMPMG--QMPVLEVD 103
            |..|.|::::.||..:|.|..:.:..||:.|.|        |.:|..:|..:.:.  .:|.| :|
Human     6 SMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYL-LD 69

  Fly   104 GK-RVHQSISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVSYEPEDEIKEKKLVT 167
            || ::.||.::.|::|:...:||.|..|.:::||:.:.:.|||....:.......:::|      
Human    70 GKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLK------ 128

  Fly   168 LNAEVIPFYLEKLEQTVKDNDGHLALGKLTWADVYFAG----ITDYMNYMV--KRDLLEP----- 221
                  |.|||:|...:|...  :.|||.:|    |||    ..|::.|.:  :..:.:|     
Human   129 ------PQYLEELPGQLKQFS--MFLGKFSW----FAGEKLTFVDFLTYDILDQNRIFDPKCLDE 181

  Fly   222 YPALRGVVDAVNALEPIKAWIE-----KRPV 247
            :|.|:..:....|||.|.|:::     |.|:
Human   182 FPNLKAFMCRFEALEKIAAYLQSDQFCKMPI 212

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 21/79 (27%)
PTZ00057 52..245 CDD:173353 55/219 (25%)
GST_C_Sigma_like 129..232 CDD:198301 25/113 (22%)
GSTM3NP_000840.2 GST_N_Mu 7..88 CDD:239373 22/81 (27%)