DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and GSTM2

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_000839.1 Gene:GSTM2 / 2946 HGNCID:4634 Length:218 Species:Homo sapiens


Alignment Length:226 Identity:60/226 - (26%)
Similarity:103/226 - (45%) Gaps:50/226 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TLFYFNVKALAEPLRYLFAYGNQEYEDVRVT--------RDEWPALKPTMPMG----QMPVLEVD 103
            ||.|:|::.||..:|.|..|.:..||:.:.|        |.:|  |.....:|    .:|.| :|
Human     4 TLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQW--LNEKFKLGLDFPNLPYL-ID 65

  Fly   104 G-KRVHQSISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVSYEPEDEIKEKKLVT 167
            | .::.||.::.|::|:...|||.:..|.::.||:.:...|.|:...: :.|:|:.|        
Human    66 GTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAK-LCYDPDFE-------- 121

  Fly   168 LNAEVIPFYLEKLEQTVKDNDGHLALGKLTWADVYFAG----ITDYMNYMV--KRDLLEP----- 221
               ::.|.||:.|.:.:|.....  |||..|    |.|    ..|::.|.|  :..:.||     
Human   122 ---KLKPEYLQALPEMLKLYSQF--LGKQPW----FLGDKITFVDFIAYDVLERNQVFEPSCLDA 177

  Fly   222 YPALRGVVDAVNALEPIKAWIEK-----RPV 247
            :|.|:..:.....||.|.|:::.     |||
Human   178 FPNLKDFISRFEGLEKISAYMKSSRFLPRPV 208

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 23/80 (29%)
PTZ00057 52..245 CDD:173353 56/221 (25%)
GST_C_Sigma_like 129..232 CDD:198301 26/113 (23%)
GSTM2NP_000839.1 GST_N_Mu 3..84 CDD:239373 24/82 (29%)