DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and GSTM1

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_000552.2 Gene:GSTM1 / 2944 HGNCID:4632 Length:218 Species:Homo sapiens


Alignment Length:226 Identity:61/226 - (26%)
Similarity:101/226 - (44%) Gaps:52/226 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LFYFNVKALAEPLRYLFAYGNQEYEDVRVT--------RDEWPALKPTMPMG----QMPVLEVDG 104
            |.|::::.||..:|.|..|.:..||:.:.|        |.:|  |.....:|    .:|.| :||
Human     5 LGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQW--LNEKFKLGLDFPNLPYL-IDG 66

  Fly   105 -KRVHQSISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVSYEPEDEIKEKKLVTL 168
             .::.||.::..::|:...|||.|..|.:::||:.:...|..:.. ..:.|.||.|         
Human    67 AHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQL-GMICYNPEFE--------- 121

  Fly   169 NAEVIPFYLEKLEQTVKDNDGHLALGKLTWADVYFAG----ITDYMNYMVKRDL--------LEP 221
              ::.|.|||:|.:.:|.....  |||..|    |||    ..|::.|.| .||        |:.
Human   122 --KLKPKYLEELPEKLKLYSEF--LGKRPW----FAGNKITFVDFLVYDV-LDLHRIFEPKCLDA 177

  Fly   222 YPALRGVVDAVNALEPIKAWIEK-----RPV 247
            :|.|:..:.....||.|.|:::.     |||
Human   178 FPNLKDFISRFEGLEKISAYMKSSRFLPRPV 208

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 20/79 (25%)
PTZ00057 52..245 CDD:173353 58/222 (26%)
GST_C_Sigma_like 129..232 CDD:198301 29/114 (25%)
GSTM1NP_000552.2 GST_N_Mu 3..84 CDD:239373 21/81 (26%)