DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and RGD1307603

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_006230798.1 Gene:RGD1307603 / 293656 RGDID:1307603 Length:210 Species:Rattus norvegicus


Alignment Length:205 Identity:56/205 - (27%)
Similarity:95/205 - (46%) Gaps:24/205 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YTLFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWP--ALKPTMPMGQMPVLEVDGK-RVHQSI 111
            ||:.||..:...|.:|.|.|...|.:::..||.|.|.  ..|.:...||:|..: ||| .::||.
  Rat     4 YTIIYFPSRGHCEVMRMLLADQGQSWKEEVVTLDVWEQGTFKASCLFGQIPKFQ-DGKLTLYQSN 67

  Fly   112 SMARFLAKTVGLCGATPWEDLQIDIVVDTIND-FRLSSEQFVSYEPEDEIKEKKLVTLNAEVIPF 175
            ::.|.|..:.||.|....|...:|:|.|.:.| ||..:..::....||:.:.:|       .:|.
  Rat    68 AILRHLGHSFGLYGKDQQEAALVDMVNDGLEDVFRRIAWHYLHICKEDKGQYRK-------ELPG 125

  Fly   176 YLEKLEQTVKDNDGHLALGKLTWADVYFAGITDY--MNYMVKRDLLEP-----YPALRGVVDAVN 233
            :|:..|..:..|.|....  :....:.||   ||  ::.::..:||.|     :|.|...|..:.
  Rat   126 HLKPFETLLAQNKGGQCF--IVGDQISFA---DYRLLDLLLNLELLFPGYLKDFPLLSAYVARLK 185

  Fly   234 ALEPIKAWIE 243
            |...:||::|
  Rat   186 ARPKLKAFLE 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 24/71 (34%)
PTZ00057 52..245 CDD:173353 54/203 (27%)
GST_C_Sigma_like 129..232 CDD:198301 25/110 (23%)
RGD1307603XP_006230798.1 GST_N_Pi 3..74 CDD:239374 23/70 (33%)
PTZ00057 6..194 CDD:173353 53/200 (27%)
GST_C_family 84..202 CDD:295467 29/124 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100172
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.