DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and gst-34

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_741060.2 Gene:gst-34 / 260015 WormBaseID:WBGene00001782 Length:218 Species:Caenorhabditis elegans


Alignment Length:220 Identity:68/220 - (30%)
Similarity:112/220 - (50%) Gaps:30/220 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SYTLFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDE---------WPALKPTMPMGQMPVLEVDG 104
            ||.|.||:::|.|||.|.||..|...|||||:..|:         :.|||...|.|:.|||.:||
 Worm     3 SYKLTYFDIRAFAEPARLLFHLGGVPYEDVRMPTDDIVPGIQSDAFLALKDKTPFGRFPVLSIDG 67

  Fly   105 KRVHQSISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFV----SYEPEDEIKEKKL 165
            ..:.||.::.|:||:..|..|.:|.::...|.:||.:.::..|....:    |.:||:|:|.   
 Worm    68 FDLAQSTAIHRYLARKFGYAGKSPEDEAFADSIVDQVKEYLESFRPLLYAQKSGKPEEEVKR--- 129

  Fly   166 VTLNAEV-IP---FYLEKLEQTVKDNDGHLALGK-LTWADVYFAGITDYMNYMVKRDLLEP---- 221
              ::.|| ||   ...:.|.:.:|::.....:|. |||||:.   :.|::..:.....|:|    
 Worm   130 --IHDEVYIPVKNLLFKILTRILKESKSEYLVGDGLTWADLV---VADHLYSLTNIKELDPEDPI 189

  Fly   222 YPALRGVVDAVNALEPIKAWIEKRP 246
            :..|:...:.:..|..:|.:||.||
 Worm   190 HLNLKKYQERIFNLPELKDYIETRP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 32/77 (42%)
PTZ00057 52..245 CDD:173353 64/214 (30%)
GST_C_Sigma_like 129..232 CDD:198301 25/115 (22%)
gst-34NP_741060.2 GST_N_Sigma_like 4..82 CDD:239337 32/77 (42%)
PTZ00057 6..213 CDD:173353 64/214 (30%)
GST_C_Sigma_like 92..200 CDD:198301 25/115 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113741
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48362
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 1 1.000 - - FOG0000305
OrthoInspector 1 1.000 - - otm14121
orthoMCL 1 0.900 - - OOG6_100172
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.690

Return to query results.
Submit another query.