DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and Gstp1

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_036709.1 Gene:Gstp1 / 24426 RGDID:2758 Length:210 Species:Rattus norvegicus


Alignment Length:217 Identity:57/217 - (26%)
Similarity:99/217 - (45%) Gaps:35/217 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YTLFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEW--PALKPTMPMGQMPVLEVDGKRVHQSIS 112
            ||:.||.|:...|..|.|.|...|.:::..||.|.|  .:||.|...||:|..|.....::||.:
  Rat     4 YTIVYFPVRGRCEATRMLLADQGQSWKEEVVTIDVWLQGSLKSTCLYGQLPKFEDGDLTLYQSNA 68

  Fly   113 MARFLAKTVGLCGATPWEDLQIDIVVDTINDFR--LSSEQFVSYE--PEDEIKEKKLVTLNAEVI 173
            :.|.|.:::||.|....|...:|:|.|.:.|.|  ..:..:.:||  .:|.:|          .:
  Rat    69 ILRHLGRSLGLYGKDQKEAALVDMVNDGVEDLRCKYGTLIYTNYENGKDDYVK----------AL 123

  Fly   174 PFYLEKLEQTVKDNDGHLAL---GKLTWADVYFAGITDYMNYMVKRDLLEP-----YPALRGVVD 230
            |.:|:..|..:..|.|..|.   .::::||.      :.::.::...:|.|     :|.|...|.
  Rat   124 PGHLKPFETLLSQNQGGKAFIVGNQISFADY------NLLDLLLVHQVLAPGCLDNFPLLSAYVA 182

  Fly   231 AVNALEPIKAWIE-----KRPV 247
            .::|...|||::.     .||:
  Rat   183 RLSARPKIKAFLSSPDHLNRPI 204

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 25/70 (36%)
PTZ00057 52..245 CDD:173353 53/211 (25%)
GST_C_Sigma_like 129..232 CDD:198301 23/114 (20%)
Gstp1NP_036709.1 GST_N_Pi 3..76 CDD:239374 25/71 (35%)