DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and Gstm2

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_803175.1 Gene:Gstm2 / 24424 RGDID:2756 Length:218 Species:Rattus norvegicus


Alignment Length:218 Identity:60/218 - (27%)
Similarity:100/218 - (45%) Gaps:47/218 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TLFYFNVKALAEPLRYLFAYGNQEYEDVRVT--------RDEWPALKPTMPMG----QMPVLEVD 103
            ||.|::::.||..:|....|.:..|||.:.:        |.:|  |.....:|    .:|.| :|
  Rat     4 TLGYWDIRGLAHAIRLFLEYTDTSYEDKKYSMGDAPDYDRSQW--LSEKFKLGLDFPNLPYL-ID 65

  Fly   104 GK-RVHQSISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVSYEPEDEIKEKKLVT 167
            |. ::.||.::.|:|.:...|||.|..|.:::|::.:...|.||.. ..|.|.|:.|.|:     
  Rat    66 GSHKITQSNAILRYLGRKHNLCGETEEERIRVDVLENQAMDTRLQL-AMVCYSPDFERKK----- 124

  Fly   168 LNAEVIPFYLEKLEQTVKDNDGHLALGKLTWADVYFAG--ITDYMNYMV-----KRDLLEP---- 221
                  |.|||.|.:.:|.....  |||..|    |||  || |::::|     :..:.||    
  Rat   125 ------PEYLEGLPEKMKLYSEF--LGKQPW----FAGNKIT-YVDFLVYDVLDQHRIFEPKCLD 176

  Fly   222 -YPALRGVVDAVNALEPIKAWIE 243
             :|.|:..|.....|:.|..:::
  Rat   177 AFPNLKDFVARFEGLKKISDYMK 199

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 22/80 (28%)
PTZ00057 52..245 CDD:173353 59/217 (27%)
GST_C_Sigma_like 129..232 CDD:198301 32/114 (28%)
Gstm2NP_803175.1 PTZ00057 3..200 CDD:173353 60/218 (28%)
GST_N_Mu 3..84 CDD:239373 22/82 (27%)