DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and gst-39

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_497119.1 Gene:gst-39 / 190226 WormBaseID:WBGene00001787 Length:209 Species:Caenorhabditis elegans


Alignment Length:213 Identity:69/213 - (32%)
Similarity:104/213 - (48%) Gaps:21/213 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YTLFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDE--WPALKPTMPMGQMPVLEVDGKRVHQSIS 112
            |.|.||:.:..|||.|.||......:||.|:|..:  |..:|...|.||:|||.|||..:.||.:
 Worm     4 YKLTYFDARGYAEPARILFHLAGVPFEDNRLTHGDGSWEKIKDKTPFGQVPVLSVDGFDIPQSAA 68

  Fly   113 MARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFV----SYEPEDEIKEKKLVTLNAEV- 172
            :.|:||...|..|.||.|....|.:||...||..:..|.:    |.:|.:||.:     :::|| 
 Worm    69 IIRYLANKFGYAGKTPEEQAWADAIVDQFKDFMGAFRQLIMAQRSGKPAEEIAK-----ISSEVA 128

  Fly   173 IP---FYLEKLEQTV-KDNDGHLALGKLTWADVYFAGITDYMNYMVKRDLL--EPYPALRGVVDA 231
            ||   .|.:.|...: |...|.|....||:||:.   :.:.:..:.|....  ..:|.|..:.:.
 Worm   129 IPARDSYFKILNGLLEKSKSGFLVGDGLTFADIV---VVENLTTLEKNQFFTASEHPKLSALREK 190

  Fly   232 VNALEPIKAWIEKRPVTE 249
            |:|:..||.|:..||.|:
 Worm   191 VHAVPAIKTWVATRPDTQ 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 29/70 (41%)
PTZ00057 52..245 CDD:173353 65/205 (32%)
GST_C_Sigma_like 129..232 CDD:198301 27/113 (24%)
gst-39NP_497119.1 GST_N_Sigma_like 4..74 CDD:239337 28/69 (41%)
PTZ00057 6..209 CDD:173353 68/211 (32%)
GST_C_Sigma_like 85..191 CDD:198301 27/113 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113741
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48362
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 1 1.000 - - FOG0000305
OrthoInspector 1 1.000 - - otm14121
orthoMCL 1 0.900 - - OOG6_100172
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.690

Return to query results.
Submit another query.