DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and gst-26

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_497115.1 Gene:gst-26 / 190223 WormBaseID:WBGene00001774 Length:209 Species:Caenorhabditis elegans


Alignment Length:219 Identity:71/219 - (32%)
Similarity:105/219 - (47%) Gaps:31/219 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SYTLFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDE--WPALKPTMPMGQMPVLEVDGKRVHQSI 111
            ||.|.|||.:...|..|.||...:..:||.|:|..:  |..||...|:||:|||.|||..:.||.
 Worm     3 SYKLTYFNARGYGEAARILFHLADVPFEDFRMTHGDGTWEKLKEKTPLGQVPVLSVDGFEIPQSA 67

  Fly   112 SMARFLAKTVGLCGATPWEDLQIDIVVDTIND----FRLSSEQFVSYEPEDEIKEKKLVTLNAEV 172
            ::.|:||...|..|.||.|....|.:||...|    ||...:...:.:|.:||.:    .:.::|
 Worm    68 AIIRYLANKFGYAGKTPEEQAWADAIVDQFKDFMGSFREVGKAHAAGKPAEEIAK----IMQSDV 128

  Fly   173 IP----FY------LEKLEQTVKDNDGHLALGKLTWADVYFAGITDYMNYMVKRDLLEP--YPAL 225
            :|    |:      |||.:......||      ||:||:.   :.:.:..:.|..|..|  .|.|
 Worm   129 VPARDAFFVIINGILEKSKSGFLVGDG------LTFADIV---VVECITTLDKNQLFTPAGEPKL 184

  Fly   226 RGVVDAVNALEPIKAWIEKRPVTE 249
            ..:.:.|.|:..||.|:|.||.|:
 Worm   185 VALREKVYAIPAIKKWVEIRPDTQ 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 29/70 (41%)
PTZ00057 52..245 CDD:173353 66/210 (31%)
GST_C_Sigma_like 129..232 CDD:198301 27/118 (23%)
gst-26NP_497115.1 GST_N_Sigma_like 4..74 CDD:239337 28/69 (41%)
PTZ00057 6..209 CDD:173353 69/216 (32%)
GST_C_Sigma_like 85..191 CDD:198301 27/118 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113741
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48362
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 1 1.000 - - FOG0000305
OrthoInspector 1 1.000 - - otm14121
orthoMCL 1 0.900 - - OOG6_100172
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.