Sequence 1: | NP_001261040.1 | Gene: | GstS1 / 36927 | FlyBaseID: | FBgn0010226 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_491056.2 | Gene: | W10C8.4 / 189332 | WormBaseID: | WBGene00021127 | Length: | 212 | Species: | Caenorhabditis elegans |
Alignment Length: | 200 | Identity: | 43/200 - (21%) |
---|---|---|---|
Similarity: | 82/200 - (41%) | Gaps: | 25/200 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 61 AEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMG---QMPVLEV-DGKRVHQSISMARFLAKTV 121
Fly 122 GLCGATPWEDLQIDIVVDTINDFRLSSEQFV------SYEPEDE----IKEKKLVTLNAEVIPFY 176
Fly 177 LEKL-EQTVKDNDGHLALGKLTWADVYFAGITDYMNYMVKRDLLEPYPALRGVVDAVNALEPIKA 240
Fly 241 WIEKR 245 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstS1 | NP_001261040.1 | GST_N_Sigma_like | 50..119 | CDD:239337 | 14/61 (23%) |
PTZ00057 | 52..245 | CDD:173353 | 42/198 (21%) | ||
GST_C_Sigma_like | 129..232 | CDD:198301 | 21/113 (19%) | ||
W10C8.4 | NP_491056.2 | Thioredoxin_like | 9..79 | CDD:294274 | 14/60 (23%) |
PTZ00057 | 14..210 | CDD:173353 | 42/199 (21%) | ||
GST_C_family | <133..205 | CDD:295467 | 18/81 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1162336at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |