DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and W10C8.4

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_491056.2 Gene:W10C8.4 / 189332 WormBaseID:WBGene00021127 Length:212 Species:Caenorhabditis elegans


Alignment Length:200 Identity:43/200 - (21%)
Similarity:82/200 - (41%) Gaps:25/200 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 AEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMG---QMPVLEV-DGKRVHQSISMARFLAKTV 121
            ||.:|.|..:.::::.|.|:|..:|.|.:......   ::||::: |.:.:...|.:.|.:|...
 Worm    18 AETIRLLLVFTHRKFTDTRLTLAQWKAKRKMAGFNDDTKLPVMKINDTRTIIGVIDICRHIALQY 82

  Fly   122 GLCGATPWEDLQIDIVVDTINDFRLSSEQFV------SYEPEDE----IKEKKLVTLNAEVIPFY 176
            ||.|::..:..::|.|:..:.:...:....:      :|:...|    .||:.|..|..|    |
 Worm    83 GLYGSSSGDQEEVDKVIQKLEELNTAMNPILRATLTKNYDARKECWNVFKEESLFPLLRE----Y 143

  Fly   177 LEKL-EQTVKDNDGHLALGKLTWADVYFAGITDYMNYMVKRDLLEPYPALRGVVDAVNALEPIKA 240
            .|.| ||.....|      :.:|||:.................|..:..||.......:|..|:.
 Worm   144 EELLGEQKFMIGD------RYSWADIAVVEFLTRCQQCYDSFYLAHFERLRTFCQTFESLPHIRP 202

  Fly   241 WIEKR 245
            :|:.|
 Worm   203 YIQGR 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 14/61 (23%)
PTZ00057 52..245 CDD:173353 42/198 (21%)
GST_C_Sigma_like 129..232 CDD:198301 21/113 (19%)
W10C8.4NP_491056.2 Thioredoxin_like 9..79 CDD:294274 14/60 (23%)
PTZ00057 14..210 CDD:173353 42/199 (21%)
GST_C_family <133..205 CDD:295467 18/81 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.