DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and gst-13

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_495967.1 Gene:gst-13 / 188915 WormBaseID:WBGene00001761 Length:208 Species:Caenorhabditis elegans


Alignment Length:208 Identity:67/208 - (32%)
Similarity:99/208 - (47%) Gaps:14/208 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YTLFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLEVDGKRVHQSISMA 114
            |.|.||..:.|.:..|.||...:.::||.|:.:..:...|.|.|..|:|||.|||.::.||:::|
 Worm     4 YKLTYFLSRGLGDVSRQLFHLADVDFEDERLEKPHFLEKKETYPFKQVPVLSVDGFQIPQSMAIA 68

  Fly   115 RFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQF--------VSYEPEDEIKEKKLVTLNAE 171
            |:|||..|..|.|..|...:|..||...||......:        ::....||.|:|.|:....:
 Worm    69 RYLAKKFGFAGKTAEESAMVDAFVDQFKDFYSEIRDYYYTMLGLGLTDLDGDEQKDKVLIPARDK 133

  Fly   172 VIPFYLEKLEQTVKDNDGHLALGKLTWAD-VYFAGITDYMNYMVKRDLLEPYPALRGVVDAVNAL 235
            .:|.....||   |...|.|..|.||:|| :....:|..:|:.  .:....||.:....|.|...
 Worm   134 FLPLLTRYLE---KSKSGFLVDGGLTFADLIILDNMTSLLNWW--PEYANDYPVILAWRDKVMNY 193

  Fly   236 EPIKAWIEKRPVT 248
            ..:|.:|||||||
 Worm   194 PRLKEYIEKRPVT 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 26/68 (38%)
PTZ00057 52..245 CDD:173353 61/201 (30%)
GST_C_Sigma_like 129..232 CDD:198301 27/111 (24%)
gst-13NP_495967.1 GST_N_Sigma_like 4..73 CDD:239337 26/68 (38%)
PTZ00057 6..208 CDD:173353 66/206 (32%)
GST_C_Sigma_like 83..190 CDD:198301 27/111 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113741
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48362
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 1 1.000 - - FOG0000305
OrthoInspector 1 1.000 - - otm14121
orthoMCL 1 0.900 - - OOG6_100172
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.690

Return to query results.
Submit another query.