DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and gst-36

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_509652.2 Gene:gst-36 / 187645 WormBaseID:WBGene00001784 Length:210 Species:Caenorhabditis elegans


Alignment Length:214 Identity:60/214 - (28%)
Similarity:106/214 - (49%) Gaps:24/214 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YTLFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLEVDGKRVHQSISMA 114
            :..:||:|:...|.:|.||...:::::|.|...::|..||..||:||:||||:||.::.|:.::|
 Worm     4 FKFYYFDVRGRGEAIRLLFHLADEKFDDERFGMEQWGVLKSEMPLGQVPVLEIDGVKISQTTAIA 68

  Fly   115 RFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQ---------FVSYEPEDEIKEKKL--VTL 168
            |:|.......|....:..::|::.:.|.:|..||..         .:....|...||..|  |..
 Worm    69 RYLGHQFHRAGTNAVDCARLDMIAEVIQEFMSSSGMGKFSRVLLGMIQANKEQFFKENVLPDVEK 133

  Fly   169 NAEVIPFYLEKLEQTVKDNDGHLALGKLTWADVY----FAGITDYMNYMVKRDLLEPYPALRGVV 229
            .|.::..:|  ||   ..|:|.|...:.||.||:    |:.:.||.:    .|.|:.||.:..::
 Worm   134 YAPIVEKFL--LE---NGNNGLLLGDRETWVDVFAAESFSKLIDYGS----PDALDAYPHILALI 189

  Fly   230 DAVNALEPIKAWIEKRPVT 248
            :.|.....||.::.:|..|
 Worm   190 NRVFNHPNIKKYVSQRKAT 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 26/68 (38%)
PTZ00057 52..245 CDD:173353 58/207 (28%)
GST_C_Sigma_like 129..232 CDD:198301 28/117 (24%)
gst-36NP_509652.2 GST_N_Sigma_like 5..72 CDD:239337 25/66 (38%)
PTZ00057 6..208 CDD:173353 59/210 (28%)
GST_C_Sigma_like 83..192 CDD:198301 28/117 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113741
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48362
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100172
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.