powered by:
Protein Alignment GstS1 and F56A4.3
DIOPT Version :9
Sequence 1: | NP_001261040.1 |
Gene: | GstS1 / 36927 |
FlyBaseID: | FBgn0010226 |
Length: | 250 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001360541.1 |
Gene: | F56A4.3 / 186346 |
WormBaseID: | WBGene00018911 |
Length: | 139 |
Species: | Caenorhabditis elegans |
Alignment Length: | 70 |
Identity: | 24/70 - (34%) |
Similarity: | 41/70 - (58%) |
Gaps: | 2/70 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 LFYFNVKALAEPLRYLFAYGNQEYEDVRVTRD--EWPALKPTMPMGQMPVLEVDGKRVHQSISMA 114
|:||.::...|.:|.||.....::||:|...: ||...|..|.:||:|.|:|||:.:.|:.::.
Worm 6 LYYFTIRGFGEYIRLLFLDNGIKFEDIRFDYEGNEWQEFKKGMLLGQLPCLKVDGQEIVQTGAIM 70
Fly 115 RFLAK 119
|.|.:
Worm 71 RHLGR 75
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1695 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1162336at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.820 |
|
Return to query results.
Submit another query.