DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and gst-18

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_496866.1 Gene:gst-18 / 185412 WormBaseID:WBGene00001766 Length:197 Species:Caenorhabditis elegans


Alignment Length:215 Identity:61/215 - (28%)
Similarity:96/215 - (44%) Gaps:35/215 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SYTLFYFNVKALAEPLRYLFAYGNQEYEDVRVT--RDEWPALKPTMPMGQMPVLEVDGKRVHQSI 111
            ||.|.||:::.|.||:|:||......:||.|:.  ...|..:|...||.|:            |.
 Worm     3 SYKLTYFSIRGLGEPIRHLFHLAGVSFEDERLAYGGSPWEQVKEKYPMSQL------------SA 55

  Fly   112 SMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVSY-----EPEDEIKEKKLVTLNAE 171
            ::.|:|.:..|..|.||.|:..:|.|||...|| ||..:.:.|     :..|||:.     :..|
 Worm    56 AILRYLGRKFGFAGKTPEEEAWVDAVVDLFKDF-LSEFKHLIYASLNGKSADEIER-----VRTE 114

  Fly   172 V-IP---FYLEKLEQTVKDNDGHLALGK-LTWADVYFAGITDYMNYMVKRDLL--EPYPALRGVV 229
            : ||   .|.:.|...:|.:.....:|. :|:||:.   :|:|:..:...:|.  ...|.|..:.
 Worm   115 IAIPARNVYFKNLNDLLKRSKSGFLIGDGITFADIV---VTNYLETLKTFELYNGSDEPKLVALQ 176

  Fly   230 DAVNALEPIKAWIEKRPVTE 249
            ..|.....||..|..|.:||
 Worm   177 KKVYEQPGIKECIATRVLTE 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 21/70 (30%)
PTZ00057 52..245 CDD:173353 56/206 (27%)
GST_C_Sigma_like 129..232 CDD:198301 28/114 (25%)
gst-18NP_496866.1 GST_N_Sigma_like 4..63 CDD:239337 21/70 (30%)
PTZ00057 6..192 CDD:173353 56/206 (27%)
GST_C_Sigma_like 73..179 CDD:198301 28/114 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113741
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48362
OrthoDB 1 1.010 - - D1162336at2759
OrthoFinder 1 1.000 - - FOG0000305
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100172
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.690

Return to query results.
Submit another query.