DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and gst-15

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_496860.1 Gene:gst-15 / 185410 WormBaseID:WBGene00001763 Length:213 Species:Caenorhabditis elegans


Alignment Length:205 Identity:67/205 - (32%)
Similarity:101/205 - (49%) Gaps:24/205 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YTLFYFNVKALAEPLRYLFAYGNQEYEDVRV----TRDEWPALKPTMPMGQMPVLEVDGKRVHQS 110
            |.|.||:::..|||.|.||...:..|:|:|:    |..:|..::...|.||:|||.|||..:.||
 Worm     4 YKLTYFDLRGWAEPARQLFHLSHTPYDDIRIPMADTEGKWEKMRDKTPFGQLPVLNVDGFDIPQS 68

  Fly   111 ISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFV----SYEPEDEIKEKKLVTLN-A 170
            .::.|:|||..|..|.||.|:...|.|||...||.::.:..:    :.:||:||.:.:....| |
 Worm    69 AAICRYLAKKFGYAGKTPEEEAWADAVVDQFKDFSVAFKTLLFATRAGKPEEEILKIRYEIFNPA 133

  Fly   171 EVIPFYLEKLEQTV-KDNDGHLALGKLTWADVYFAGITDYMNYMVKRDLLEPYPALRGVVDAVNA 234
            ..:.|.|  |.:.: |...|:|....|||||:..|            |.|.....||.:.|....
 Worm   134 RDVYFIL--LNRILKKSKSGYLVGDGLTWADLVIA------------DNLHSLEKLRAIDDDDEG 184

  Fly   235 LEPIKAWIEK 244
            .:.:|.:.||
 Worm   185 HQNLKKYKEK 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 28/72 (39%)
PTZ00057 52..245 CDD:173353 66/203 (33%)
GST_C_Sigma_like 129..232 CDD:198301 30/108 (28%)
gst-15NP_496860.1 GST_N_Sigma_like 4..77 CDD:239337 28/72 (39%)
PTZ00057 6..211 CDD:173353 66/203 (33%)
GST_C_Sigma_like 87..195 CDD:198301 33/122 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113741
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48362
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000305
OrthoInspector 1 1.000 - - otm14121
orthoMCL 1 0.900 - - OOG6_100172
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.680

Return to query results.
Submit another query.