DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstS1 and gst-24

DIOPT Version :9

Sequence 1:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_496859.1 Gene:gst-24 / 185407 WormBaseID:WBGene00001772 Length:209 Species:Caenorhabditis elegans


Alignment Length:216 Identity:70/216 - (32%)
Similarity:96/216 - (44%) Gaps:33/216 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YTLFYFNVKALAEPLRYLFAYGNQEYEDVRVTR--DEWPALKPTMPMGQMPVLEVDGKRVHQSIS 112
            |.|:|||::..|||.|.||...:.|:||||:..  .||.||||..|.||:|.|.|||..:.||.:
 Worm     4 YKLYYFNLRGWAEPARQLFKLAHVEFEDVRIENGTPEWGALKPKTPFGQLPFLSVDGFEIPQSAA 68

  Fly   113 MARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVSYEPEDEIKEKKLVTLNAEVIPFYL 177
            :.|:|||..|..|.|..|:..:|.:||...||.....|.:..:...          |||.|    
 Worm    69 ILRYLAKKFGYAGKTSEEEAWVDAIVDQFKDFVTPLRQLIMAQRSG----------NAEEI---- 119

  Fly   178 EKLEQTV-----------------KDNDGHLALGKLTWADVYFAGITDYMNYMVKRDLLEPYPAL 225
            |::::.|                 |...|.|....:||||:..|.|...|..:...|.......|
 Worm   120 ERIQKEVFAPARDTFFKILNGILEKSKSGFLVGDGVTWADLVIADILTTMEMLGVFDKHGEEQKL 184

  Fly   226 RGVVDAVNALEPIKAWIEKRP 246
            ..:.:.||.:..||.....||
 Worm   185 AALREKVNEIPEIKEHNSSRP 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 34/70 (49%)
PTZ00057 52..245 CDD:173353 67/211 (32%)
GST_C_Sigma_like 129..232 CDD:198301 25/119 (21%)
gst-24NP_496859.1 GST_N_Sigma_like 4..75 CDD:239337 34/70 (49%)
PTZ00057 6..208 CDD:173353 69/214 (32%)
GST_C_Sigma_like 85..191 CDD:198301 25/119 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1695
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H113741
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48362
OrthoDB 1 1.010 - - D548817at33208
OrthoFinder 1 1.000 - - FOG0000305
OrthoInspector 1 1.000 - - otm14121
orthoMCL 1 0.900 - - OOG6_100172
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.690

Return to query results.
Submit another query.